Recombinant Human Secreted and Transmembrane Protein 1, SECTM1, CD7L, K12 (C-6His)

Contact us
Catalog number: CA49
Price: 350 €
Supplier: Bioss Primary Conjugated Antibodies
Product name: Recombinant Human Secreted and Transmembrane Protein 1, SECTM1, CD7L, K12 (C-6His)
Quantity: 0.1ml
Other quantities: 10 µg 141€ 50 µg 303€ 500 µg 1115€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Secreted and Transmembrane Protein 1 is produced by our Mammalian expression system and the target gene encoding Gln29-Gly145 is expressed with a 6His tag at the C-terminus
Molecular Weight: 13, 75 kD
UniProt number: Q8WVN6
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: QNEGWDSPICTEGVVSVSWGENTVMSCNISNAFSHVNIKLRAHGQESAIFNEVAPGYFSRDGWQLQVQGGVAQLVIKGARDSHAGLYMWHLVGHQRNNRQVTLEVSGAEPQSAPDTGVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: CD7L, K12 (C-6His), SECTM1, Secreted Transmembrane Protein 1
Short name: CD7L, K12 (C-6His), SECTM1, Recombinant Secreted Transmembrane Protein 1
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: CD7L, K12 (C-6His), sapiens Secreted and Transmembrane Protein 1, secreted and transmembrane 1, recombinant H
Alternative technique: rec
Alternative to gene target: Extracellular, K12, SECTM1 and IDBG-73454 and ENSG00000141574 and 6398, cytokine activity, this GO :0004871 and signal transducer activity and molecular function this GO :0005125 and cytokine activity and molecular function this GO :0005615 and extracellular space and cellular component this GO :0005794 and this GO lgi apparatus and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006955 and immune response and biological process this GO :0007165 and signal transduction and biological process this GO :0007498 and mesoderm development and biological process this GO :0016021 and integral component of membrane and cellular component this GO :0043123 and positive regulation of I-kappaB kinase/NF-kappaB signaling and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0004871 : signal transducer activity, this GO :0004871 : signal transducer activity and also this GO :0005125 : cytokine activity, this GO :0005125 : cytokine activity, secreted and transmembrane 1
Identity: 10707
Gene: SECTM1 | More about : SECTM1
Long gene name: secreted and transmembrane 1
Synonyms: K12
Synonyms name: K12 protein type 1a transmembrane protein
Locus: 17q25
Discovery year: 1997-10-27
GenBank acession: U77643
Entrez gene record: 6398
Pubmed identfication: 9480746
RefSeq identity: NM_003004
Havana BLAST/BLAT: OTTHUMG00000178668

Related Products :

CA49 Recombinant Human Secreted and Transmembrane Protein 1, SECTM1, CD7L, K12 (C-6His) 1 mg 1674 € novo human
DL-SECTM1-Hu Human Secreted And Transmembrane Protein 1 SECTM1 ELISA Kit 96T 974 € DL elisas human
EKU07212 Secreted And Transmembrane Protein 1 (SECTM1) ELISA kit 1 plate of 96 wells 899 € Biomatik ELISA kits human
RP-1378H Recombinant Human SECTM1 / K12 Protein (His Tag) 50μg 624 € adv human
MBS622941 WISP1 (Wnt 1 induced Secreted Protein 1, Wnt-1-induced Secreted Protein 1, Wnt1-induced Secreted Protein 1, WISP 1, WISP-1, CCN4, WISP1c, WISP1i, WISP1tc, Wnt-1-induced Secreted Protein, Wnt1-induced Secreted Protein, Wnt-1-inducible Signaling Pathway Pro Antibody 100ug 591 € MBS Polyclonals_1 human
MBS619465 Transmembrane Trafficking Protein 21kD (21kD Transmembrane Trafficking Protein, TMP21, Tmp 21-I, Tmp21-I, Tmp-21-I, Transmembrane Protein Tmp21, 1110014C03Rik, MGC102351, p23, p24delta, p24delta1, S31I125, S31III125, Transmembrane emp24 Domain-containing Antibody 100ul 597 € MBS Polyclonals_1 human
MBS619689 Osteoactivin (Glycoprotein (transmembrane) nmb, Gpnmb, Dchil, DC-HIL, Dendritic cell-associated transmembrane protein, ipd, Nmb, Osteoactivin, Transmembrane glycoprotein NMB) 100ul 1199 € MBS Polyclonals_1 human
CJ71 Recombinant Human V-Set and Transmembrane Domain-Containing 1, VSTM1 (C-6His) 10 µg 156 € novo human
CI23 Recombinant Human V-Set and Transmembrane Domain-Containing 2A, VSTM2A (C-6His) 500 µg 1613 € novo human
C544 Recombinant Human Secreted Phosphoprotein 1, SPP1 , SPP1 (C-6His) 10 µg 100 € novo human
MBS619345 SFRP2, CT (Secreted Frizzled-related Protein 2, FRP-2, SARP1, SDF-5, Secreted Apoptosis Related Protein 1) Antibody 100ug 741 € MBS Polyclonals_1 human
MBS619998 SFRP2 (Secreted Frizzled-related Protein 2, FRP-2, SARP1, SDF-5, Secreted Apoptosis Related Protein 1) 100ug 591 € MBS Polyclonals_1 human
abx153041 Anti-Human SECTM1 ELISA Kit 96 tests 992 € abbex human
abx573539 Anti-Human SECTM1 ELISA Kit inquire 50 € abbex human
LV299251 SECTM1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
C348 Recombinant Human Fibronectin Leucine Rich Transmembrane Protein 1, FLRT1 (C-6His) 500 µg 1613 € novo human
C349 Recombinant Human Fibronectin Leucine Rich Transmembrane Protein 2, FLRT2 (C-6His) 500 µg 1613 € novo human
C970 Recombinant Human Leucine-Rich Repeat Transmembrane Protein FLRT3, FLRT3 (C-6His) 50 µg 369 € novo human
GENTAUR-58be5a32e306b Anti-SECTM1 (Polyclonal), ALEXA Fluor 594 100 microliters 489 € Bioss Polyclonal Antibodies human
GWB-MQ096F SECTM1 antibody 1 vial 521 € genways human
R32327 SECTM1 Antibody 0.1mg 406 € NJS poly human
bs-10153R-A350 SECTM1 Antibody, ALEXA FLUOR 350 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-10153R-A488 SECTM1 Antibody, ALEXA FLUOR 488 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-10153R-A555 SECTM1 Antibody, ALEXA FLUOR 555 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-10153R-A594 SECTM1 Antibody, ALEXA FLUOR 594 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-10153R-A647 SECTM1 Antibody, ALEXA FLUOR 647 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-10153R-Biotin SECTM1 Antibody, Biotin Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-10153R SECTM1 Antibody 0.1ml 263 € Bioss Primary Unconjugated Antibodies human
bs-10153R-Cy3 SECTM1 Antibody, Cy3 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-10153R-Cy5 SECTM1 Antibody, Cy5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human