| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human FLRT1 is produced by our Mammalian expression system and the target gene encoding Ile21-Pro524 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
52 kD, 56 |
| UniProt number: |
Q9NZU1 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
IDSTTCPSVCRCDNGFIYCNDRGLTSIPADIPDDATTLYLQNNQINNAGIPQDLKTKVNVQVIYLYENDLDEFPINLPRSLRELHLQDNNVRTIARDSLARIPLLEKLHLDDNSVSTVSIEEDAFADSKQLKLLFLSRNHLSSIPSGLPHTLEELRLDDNRISTIPLHAFKGLNSLRRLVLDGNLLANQRIADDTFSRLQNLTELSLVRNSLAAPPLNLPSAHLQKLYLQDNAISHIPYNTLAKMRELERLDLSNNNLTTLPRGLFDDLGNLAQLLLRNNPWFCGCNLMWLRDWVKARAAVVNVRGLMCQGPEKVRGMAIKDITSEMDECFETGPQGGVANAAAKTTASNHASATTPQGSLFTLKAKRPGLRLPDSNIDYPMATGDGAKTLAIHVKALTADSIRITWKATLPASSFRLSWLRLGHSPAVGSITETLVQGDKTEYLLTALEPKSTYIICMVTMETSNAYVADETPVCAKAETADSYGPTTTLNQEQNAGPMASLPVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
FLRT1 (C-6His), Fibronectin Leucine Rich Transmembrane Protein 1 |
| Short name: |
FLRT1 (C-6His), Recombinant Fibronectin Leucine Rich Transmembrane Protein 1 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
fibronectin leucine rich transmembrane protein 1 (C-6His), sapiens Fibronectin Leucine Rich Transmembrane Protein 1, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
Extracellular, FLRT1 and IDBG-53074 and ENSG00000126500 and 23769, FLRT1 and IDBG-648487 and ENSBTAG00000048264 and 788007, Flrt1 and IDBG-138288 and ENSMUSG00000047787 and 396184, SPG68, bridging, bridging, bridging and molecular function this GO :0035556 and intracellular signal transduction and biological process, protein binding, this GO :0005057 and receptor signaling protein activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005578 and proteinaceous extracellular matrix and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0007155 and cell adhesion and biological process this GO :0008150 and biological process and biological process this GO :0030674 and protein binding, this GO :0005057 : receptor signaling protein activity, this GO :0005057 : receptor signaling protein activity and also this GO :0005515 : protein binding and also this GO :0030674 : protein binding, this GO :0005515 : protein binding, this GO :0030674 : protein binding, fibronectin leucine rich transmembrane protein 1 |
| Identity: |
3760 |
| Gene: |
FLRT1 |
More about : FLRT1 |
| Long gene name: |
fibronectin leucine rich transmembrane protein 1 |
| Synonyms: |
MGC21624 SPG68 |
| Locus: |
11q13, 1 |
| Discovery year: |
1999-10-29 |
| GenBank acession: |
AF169675 |
| Entrez gene record: |
23769 |
| Pubmed identfication: |
10644439 24482476 |
| RefSeq identity: |
NM_013280 |
| Classification: |
Fibronectin type III domain containing |
| Havana BLAST/BLAT: |
OTTHUMG00000167788 |