| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Secreted and Transmembrane Protein 1 is produced by our Mammalian expression system and the target gene encoding Gln29-Gly145 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
13, 75 kD |
| UniProt number: |
Q8WVN6 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
QNEGWDSPICTEGVVSVSWGENTVMSCNISNAFSHVNIKLRAHGQESAIFNEVAPGYFSRDGWQLQVQGGVAQLVIKGARDSHAGLYMWHLVGHQRNNRQVTLEVSGAEPQSAPDTGVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
CD7L, K12 (C-6His), SECTM1, Secreted Transmembrane Protein 1 |
| Short name: |
CD7L, K12 (C-6His), SECTM1, Recombinant Secreted Transmembrane Protein 1 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
CD7L, K12 (C-6His), sapiens Secreted and Transmembrane Protein 1, secreted and transmembrane 1, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
Extracellular, K12, SECTM1 and IDBG-73454 and ENSG00000141574 and 6398, cytokine activity, this GO :0004871 and signal transducer activity and molecular function this GO :0005125 and cytokine activity and molecular function this GO :0005615 and extracellular space and cellular component this GO :0005794 and this GO lgi apparatus and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006955 and immune response and biological process this GO :0007165 and signal transduction and biological process this GO :0007498 and mesoderm development and biological process this GO :0016021 and integral component of membrane and cellular component this GO :0043123 and positive regulation of I-kappaB kinase/NF-kappaB signaling and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0004871 : signal transducer activity, this GO :0004871 : signal transducer activity and also this GO :0005125 : cytokine activity, this GO :0005125 : cytokine activity, secreted and transmembrane 1 |
| Identity: |
10707 |
| Gene: |
SECTM1 |
More about : SECTM1 |
| Long gene name: |
secreted and transmembrane 1 |
| Synonyms: |
K12 |
| Synonyms name: |
K12 protein type 1a transmembrane protein |
| Locus: |
17q25 |
| Discovery year: |
1997-10-27 |
| GenBank acession: |
U77643 |
| Entrez gene record: |
6398 |
| Pubmed identfication: |
9480746 |
| RefSeq identity: |
NM_003004 |
| Havana BLAST/BLAT: |
OTTHUMG00000178668 |