| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
SECTM1 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur, Mouse (Mus musculus) |
| Tested applications: |
WB |
| Recommended dilutions: |
1-0, 5ug/ml, Western blot: 0 |
| Notes: |
Optimal dilution of the SECTM1 antibody should be determined by the researcher |
| Intented use: |
This SECTM1 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
Q9JL59 |
| Purity: |
Antigen affinity |
| Description: |
It is found in a perinuclear Golgi-like pattern and thought to be involved in hematopoietic and/or immune system processes, Secreted and transmembrane protein 1 is a protein that in humans is encoded by the SECTM1 gene, This gene encodes a transmembrane and secreted protein with characteristics of a type 1a transmembrane protein, SECTM1B is also known as Sectm1 or K12 |
| Immunogen: |
Amino acids KLHGFQAEFKNFNLTVNAADRQKTEDLPVTKVPDK of mouse SECTM1 were used as the immunogen for the SECTM1 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the SECTM1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
SECTM1 |
| Short name: |
SECTM1 Antibody |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
secreted and transmembrane 1 (Antibody to) |
| Alternative technique: |
antibodies |
| Alternative to gene target: |
Extracellular, K12, SECTM1 and IDBG-73454 and ENSG00000141574 and 6398, cytokine activity, this GO :0004871 and signal transducer activity and molecular function this GO :0005125 and cytokine activity and molecular function this GO :0005615 and extracellular space and cellular component this GO :0005794 and this GO lgi apparatus and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006955 and immune response and biological process this GO :0007165 and signal transduction and biological process this GO :0007498 and mesoderm development and biological process this GO :0016021 and integral component of membrane and cellular component this GO :0043123 and positive regulation of I-kappaB kinase/NF-kappaB signaling and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0004871 : signal transducer activity, this GO :0004871 : signal transducer activity and also this GO :0005125 : cytokine activity, this GO :0005125 : cytokine activity, secreted and transmembrane 1 |
| Identity: |
10707 |
| Gene: |
SECTM1 |
More about : SECTM1 |
| Long gene name: |
secreted and transmembrane 1 |
| Synonyms: |
K12 |
| Synonyms name: |
K12 protein type 1a transmembrane protein |
| Locus: |
17q25 |
| Discovery year: |
1997-10-27 |
| GenBank acession: |
U77643 |
| Entrez gene record: |
6398 |
| Pubmed identfication: |
9480746 |
| RefSeq identity: |
NM_003004 |
| Havana BLAST/BLAT: |
OTTHUMG00000178668 |