SECTM1 Antibody

Contact us
Catalog number: R32327
Price: 729 €
Supplier: genways
Product name: SECTM1 Antibody
Quantity: 1 tube
Other quantities: 0.1ml 263€ 1 vial 521€
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: SECTM1
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur, Mouse (Mus musculus)
Tested applications: WB
Recommended dilutions: 1-0, 5ug/ml, Western blot: 0
Notes: Optimal dilution of the SECTM1 antibody should be determined by the researcher
Intented use: This SECTM1 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: Q9JL59
Purity: Antigen affinity
Description: It is found in a perinuclear Golgi-like pattern and thought to be involved in hematopoietic and/or immune system processes, Secreted and transmembrane protein 1 is a protein that in humans is encoded by the SECTM1 gene, This gene encodes a transmembrane and secreted protein with characteristics of a type 1a transmembrane protein, SECTM1B is also known as Sectm1 or K12
Immunogen: Amino acids KLHGFQAEFKNFNLTVNAADRQKTEDLPVTKVPDK of mouse SECTM1 were used as the immunogen for the SECTM1 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the SECTM1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: SECTM1
Short name: SECTM1 Antibody
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: secreted and transmembrane 1 (Antibody to)
Alternative technique: antibodies
Alternative to gene target: Extracellular, K12, SECTM1 and IDBG-73454 and ENSG00000141574 and 6398, cytokine activity, this GO :0004871 and signal transducer activity and molecular function this GO :0005125 and cytokine activity and molecular function this GO :0005615 and extracellular space and cellular component this GO :0005794 and this GO lgi apparatus and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006955 and immune response and biological process this GO :0007165 and signal transduction and biological process this GO :0007498 and mesoderm development and biological process this GO :0016021 and integral component of membrane and cellular component this GO :0043123 and positive regulation of I-kappaB kinase/NF-kappaB signaling and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0004871 : signal transducer activity, this GO :0004871 : signal transducer activity and also this GO :0005125 : cytokine activity, this GO :0005125 : cytokine activity, secreted and transmembrane 1
Identity: 10707
Gene: SECTM1 | More about : SECTM1
Long gene name: secreted and transmembrane 1
Synonyms: K12
Synonyms name: K12 protein type 1a transmembrane protein
Locus: 17q25
Discovery year: 1997-10-27
GenBank acession: U77643
Entrez gene record: 6398
Pubmed identfication: 9480746
RefSeq identity: NM_003004
Havana BLAST/BLAT: OTTHUMG00000178668

Related Products :

GWB-MQ096F SECTM1 antibody 1 vial 521 € genways human
R32327 SECTM1 Antibody 0.1mg 406 € NJS poly human
bs-10153R-A350 SECTM1 Antibody, ALEXA FLUOR 350 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-10153R-A488 SECTM1 Antibody, ALEXA FLUOR 488 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-10153R-A555 SECTM1 Antibody, ALEXA FLUOR 555 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-10153R-A594 SECTM1 Antibody, ALEXA FLUOR 594 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-10153R-A647 SECTM1 Antibody, ALEXA FLUOR 647 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-10153R-Biotin SECTM1 Antibody, Biotin Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-10153R SECTM1 Antibody 0.1ml 263 € Bioss Primary Unconjugated Antibodies human
bs-10153R-Cy3 SECTM1 Antibody, Cy3 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-10153R-Cy5 SECTM1 Antibody, Cy5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-10153R-Cy5.5 SECTM1 Antibody, Cy5.5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-10153R-Cy7 SECTM1 Antibody, Cy7 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-10153R-FITC SECTM1 Antibody, FITC Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-10153R-HRP SECTM1 Antibody, HRP Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
abx153041 Anti-Human SECTM1 ELISA Kit 96 tests 992 € abbex human
abx573539 Anti-Human SECTM1 ELISA Kit inquire 50 € abbex human
GENTAUR-58be5a32e306b Anti-SECTM1 (Polyclonal), ALEXA Fluor 594 100 microliters 489 € Bioss Polyclonal Antibodies human
DL-SECTM1-Hu Human Secreted And Transmembrane Protein 1 SECTM1 ELISA Kit 96T 974 € DL elisas human
CA49 Recombinant Human Secreted and Transmembrane Protein 1, SECTM1, CD7L, K12 (C-6His) 1 mg 1674 € novo human
RP-1378H Recombinant Human SECTM1 / K12 Protein (His Tag) 50μg 624 € adv human
EKU07212 Secreted And Transmembrane Protein 1 (SECTM1) ELISA kit 1 plate of 96 wells 899 € Biomatik ELISA kits human
LV299251 SECTM1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
GWB-4E3CF6 antibody to or anti- CXC Chemokine Receptor 4 (CXCR4) Rabbit antibody to or anti-Human Polyclonal antibody antibody 1 x 1 vial 602 € genways human
GWB-BFD0EE antibody to or anti- Affinity Purified Chicken antibody to or anti-Pig CRP antibody 1 vial 414 € genways pig
GWB-75D1D0 antibody to or anti-ALPHA-1-antibody to or anti-TRYPSIN antibody 1 tube 667 € genways human
GWB-B22D54 antibody to or anti-ALPHA-1-antibody to or anti-TRYPSIN (Human Plasma) (Goat) antibody 1 vial 667 € genways human
GWB-B43069 antibody to or anti-Apaf1 (Mouse) Monoclonal antibody , antibody 1 vial 573 € genways mouse
GWB-A68C2D antibody to or anti- Brain-specificity angiogenesis inhibitor 2 antibody to or anti-Human antibody 1 vial 602 € genways human
GWB-6B2DC9 antibody to or anti- Control Immune Serum goat antibody to or anti- peptide sequence Carrier antibody 1 tube 729 € genways human