Recombinant Human Serpin F1, PEDF(C-6His)

Contact us
Catalog number: C538
Price: 496 €
Supplier: novo
Product name: Recombinant Human Serpin F1, PEDF(C-6His)
Quantity: 50 µg
Other quantities: 1 mg 2283€ 10 µg 156€ 50 µg 369€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Serpin F1/PEDF is produced by our Mammalian expression system and the target gene encoding Gln20-Pro418 is expressed with a 6His tag at the C-terminus
Molecular Weight: 42 kD, 45
UniProt number: P36955
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 8, 2 um filtered solution of 20 mM TrisHCl, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: QNPASPPEEGSPDPDSTGALVEEEDPFFKVPVNKLAAAVSNFGYDLYRVRSSTSPTTNVLLSPLSVATALSALSLGAEQRTESIIHRALYYDLISSPDIHGTYKELLDTVTAPQKNLKSASRIVFEKKLRIKSSFVAPLEKSYGTRPRVLTGNPRLDLQEINNWVQAQMKGKLARSTKEIPDEISILLLGVAHFKGQWVTKFDSRKTSLEDFYLDEERTVRVPMMSDPKAVLRYGLDSDLSCKIAQLPLTGSMSIIFFLPLKVTQNLTLIEESLTSEFIHDIDRELKTVQAVLTVPKLKLSYEGEVTKSLQEMKLQSLFDSPDFSKITGKPIKLTQVEHRAGFEWNEDGAGTTPSPGLQPAHLTFPLDYHLNQPFIFVLRDTDTGALLFIGKILDPRGPVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: PEDF(C-6His), Serpin F1
Short name: PEDF(C-6His), Recombinant Serpin F1
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: PEDF(C-6His), sapiens Serpin F1, recombinant H
Alternative technique: rec
Identity: 8824
Gene: SERPINF1 | More about : SERPINF1
Long gene name: serpin family F member 1
Synonyms gene: PEDF
Synonyms gene name: clade F (alpha-2 antiplasmin, clade F (alpha-2 antiplasmin, member 1 serpin peptidase inhibitor, member 1 sserpin family F member 1 , pigment epithelium derived factor), pigment epithelium derived factor), serine (or cysteine) proteinase inhibitor
Synonyms: EPC-1 PIG35
Synonyms name: pigment epithelium-derived factor proliferation-inducing protein 35
Locus: 17p13, 3
Discovery year: 1993-05-18
GenBank acession: M76979
Entrez gene record: 5176
Pubmed identfication: 8434014 24172014
RefSeq identity: NM_002615
Classification: Serpin peptidase inhibitors
Havana BLAST/BLAT: OTTHUMG00000090571
Locus Specific Databases: SERPINF1 variant database

Related Products :

C538 Recombinant Human Serpin F1, PEDF(C-6His) 50 µg 369 € novo human
MBS622823 SERPINA10 (Serpin Peptidase Inhibitor Clade A (alpha-1 Antiproteinase Antitrypsin) Member 10, Serpin A10, Protein Z-dependent Protease Inhibitor, Protein Z-dependent Protease Inhibitor Precursor, PZ-dependent Protease Inhibitor, PZI, ZPI) 100ug 735 € MBS Polyclonals_1 human
MBS619680 SERPINB6 (Serpin Peptidase Inhibitor Clade B (Ovalbumin) Member 6, Serpin B6, Cytoplasmic Antiproteinase, CAP, MGC111370, MSTP057, Placental Thrombin Inhibitor, PTI, Protease Inhibitor 6, Protease Inhibitor 6 (Placental Thrombin Inhibitor), PI6, PI-6) Antibody 100ug 735 € MBS Polyclonals_1 human
MBS621879 SERPINB9 (Serpin Peptidase Inhibitor Clade B (Ovalbumin) Member 9, Serpin B9, Cytoplasmic Antiproteinase 3, CAP3, CAP-3, Protease Inhibitor 9, PI9, PI-9) 100ug 735 € MBS Polyclonals_1 human
CB56 Recombinant Human Angiotensinogen, Serpin A8, AGT (C-6His) 50 µg 496 € novo human
CJ01 Recombinant Human Leukocyte Elastase Inhibitor, Serpin B1, SERPINB1 (C-6His) 1 mg 2283 € novo human
C533 Recombinant Human Serpin A1, alpha-1-Antitrypsin (C-6His) 500 µg 1613 € novo human
CA54 Recombinant Human Serpin A10, ZPI (C-6His) 500 µg 1613 € novo human
C534 Recombinant Human Serpin A3, alpha-1-Antichymotrypsin (C-6His) 1 mg 2283 € novo human
C928 Recombinant Human Serpin A4, Kallistatin (C-6His) 1 mg 2283 € novo human
C535 Recombinant Human Serpin A5, Protein C Inhibitor (C-6His) 500 µg 1613 € novo human
C639 Recombinant Human Serpin A6 , Transcortin (C-6His) 50 µg 496 € novo human
C536 Recombinant Human Serpin A7, TBG (C-6His) 50 µg 369 € novo human
CI96 Recombinant Human Serpin B12, SERPINB12 (C-6His) 500 µg 1613 € novo human
CJ63 Recombinant Human Serpin B3, SERPINB3, SCCA1 (C-6His) 1 mg 2486 € novo human
CM24 Recombinant Human Serpin B3, SERPINB3, SCCA1 (N-6His) 50 µg 496 € novo human
CE54 Recombinant Human Serpin B6, Placental Thrombin Inhibitor (N-Trx, 6His) 50 µg 496 € novo human
CJ32 Recombinant Human Serpin B9, SERPINB9 (C-6His) 50 µg 303 € novo human
C537 Recombinant Human Serpin E1, PAI-1 (C-6His) 10 µg 202 € novo human
C539 Recombinant Human Serpin G1, C1 Inhibitor (C-6His) 50 µg 369 € novo human
C800 Recombinant Human Serpin H1 (C-6His) 1 mg 2283 € novo human
CJ02 Recombinant Human Serpin I2 (C-6His) 500 µg 1613 € novo human
C542 Recombinant Human Serpin Kazal-1 (C-6His) 500 µg 1613 € novo human
C543 Recombinant Human Serpin Kazal-4, SPINK4 (C-6His) 500 µg 1613 € novo human
CJ18 Recombinant Human Serpin Kazal-7, SPINK7, ECG2 (C-6His) 1 mg 2486 € novo human
C685 Recombinant Mouse Alpha-1-antitrypsin 1-1, Serpin A1a (C-6His) 1 mg 2486 € novo mouse
C695 Recombinant Mouse α-1-Antitrypsin 1-3, SERPIN A1b (C-6His) 10 µg 202 € novo human
CD21 Recombinant Mouse Plasminogen Activator Inhibitor 1, PAI-1, SERPIN E1 (C-6His) 1 mg 2486 € novo mouse
C665 Recombinant Mouse Serine Protease Inhibitor A3N, Serpin A3N (C-6His) 1 mg 2486 € novo mouse
CK98 Recombinant Mouse Serpin D1, Heparin Cofactor II, HCF2 (C-6His) 50 µg 496 € novo mouse