| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Serpin F1/PEDF is produced by our Mammalian expression system and the target gene encoding Gln20-Pro418 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
42 kD, 45 |
| UniProt number: |
P36955 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, pH 8, 2 um filtered solution of 20 mM TrisHCl, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
QNPASPPEEGSPDPDSTGALVEEEDPFFKVPVNKLAAAVSNFGYDLYRVRSSTSPTTNVLLSPLSVATALSALSLGAEQRTESIIHRALYYDLISSPDIHGTYKELLDTVTAPQKNLKSASRIVFEKKLRIKSSFVAPLEKSYGTRPRVLTGNPRLDLQEINNWVQAQMKGKLARSTKEIPDEISILLLGVAHFKGQWVTKFDSRKTSLEDFYLDEERTVRVPMMSDPKAVLRYGLDSDLSCKIAQLPLTGSMSIIFFLPLKVTQNLTLIEESLTSEFIHDIDRELKTVQAVLTVPKLKLSYEGEVTKSLQEMKLQSLFDSPDFSKITGKPIKLTQVEHRAGFEWNEDGAGTTPSPGLQPAHLTFPLDYHLNQPFIFVLRDTDTGALLFIGKILDPRGPVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
PEDF(C-6His), Serpin F1 |
| Short name: |
PEDF(C-6His), Recombinant Serpin F1 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
PEDF(C-6His), sapiens Serpin F1, recombinant H |
| Alternative technique: |
rec |
| Identity: |
8824 |
| Gene: |
SERPINF1 |
More about : SERPINF1 |
| Long gene name: |
serpin family F member 1 |
| Synonyms gene: |
PEDF |
| Synonyms gene name: |
clade F (alpha-2 antiplasmin, clade F (alpha-2 antiplasmin, member 1 serpin peptidase inhibitor, member 1 sserpin family F member 1 , pigment epithelium derived factor), pigment epithelium derived factor), serine (or cysteine) proteinase inhibitor |
| Synonyms: |
EPC-1 PIG35 |
| Synonyms name: |
pigment epithelium-derived factor proliferation-inducing protein 35 |
| Locus: |
17p13, 3 |
| Discovery year: |
1993-05-18 |
| GenBank acession: |
M76979 |
| Entrez gene record: |
5176 |
| Pubmed identfication: |
8434014 24172014 |
| RefSeq identity: |
NM_002615 |
| Classification: |
Serpin peptidase inhibitors |
| Havana BLAST/BLAT: |
OTTHUMG00000090571 |
| Locus Specific Databases: |
SERPINF1 variant database |