| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
present in lysates used as reference for ELISA quantification of these molecules and their subunits, Whole adhesion and interacting molecules are |
| Molecular Weight: |
34, 68 kD |
| UniProt number: |
Q8N126 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
NLSQDDSQPWTSDETVVAGGTVVLKCQVKDHEDSSLQWSNPAQQTLYFGEKRALRDNRIQLVTSTPHELSISISNVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKPIITGYKSSLREKDTATLNCQSSGSKPAARLTWRKGDQELHGEPTRIQEDPNGKTFTVSSSVTFQVTREDDGASIVCSVNHESLKGADRSTSQRIEVLYTPTAMIRPDPPHPREGQKLLLHCEGRGNPVPQQYLWEKEGSVPPLKMTQESALIFPFLNKSDSGTYGCTATSNMGSYKAYYTLNVNDPSPVPSSSSTYHVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
CADM3, IGSF4B, SynCAM3 (C-6His), Adhesion Molecule 3 |
| Short name: |
CADM3, IGSF4B, SynCAM3 (C-6His), Recombinant Cell Adhesion Molecule 3 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
IGSF4B, SynCAM3 (C-6His), cellular adhesion molecule 3, sapiens cellular Adhesion Molecule 3, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
CADM3 and IDBG-103868 and ENSG00000162706 and 57863, CADM3 and IDBG-630783 and ENSBTAG00000003217 and 531178, Cadm3 and IDBG-205840 and ENSMUSG00000005338 and 94332, Cell surfaces, protein homodimerization activity, this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0005911 and cell-cell junction and cellular component this GO :0007156 and homophilic cell adhesion and biological process this GO :0007157 and heterophilic cell-cell adhesion and biological process this GO :0008104 and protein localization and biological process this GO :0016021 and integral component of membrane and cellular component this GO :0034329 and cell junction assembly and biological process this GO :0034332 and adherens junction organization and biological process this GO :0042803 and protein homodimerization activity and molecular function this GO :0045216 and cell-cell junction organization and biological process, this GO :0005515 : protein binding, this GO :0005515 : protein binding and also this GO :0042803 : protein homodimerization activity, this GO :0042803 : protein homodimerization activity, cell adhesion molecule 3 |
| Identity: |
17601 |
| Gene: |
CADM3 |
More about : CADM3 |
| Long gene name: |
cell adhesion molecule 3 |
| Synonyms gene: |
IGSF4B |
| Synonyms gene name: |
immunoglobulin superfamily, member 4B |
| Synonyms: |
BIgR FLJ10698 TSLL1 NECL1 SynCAM3 Necl-1 |
| Synonyms name: |
nectin-like 1 |
| Locus: |
1q23, 2 |
| Discovery year: |
2004-02-24 |
| GenBank acession: |
AY046418 |
| Entrez gene record: |
57863 |
| Pubmed identfication: |
11536053 |
| RefSeq identity: |
NM_021189 |
| Classification: |
C2-set domain containing Immunoglobulin like domain containing V-set domain containing |
| Havana BLAST/BLAT: |
OTTHUMG00000037177 |