Recombinant Human Hepatocyte Cell Adhesion Molecule, HepaCAM (C-6His)

Contact us
Catalog number: C522
Price: 615 €
Supplier: abbex
Product name: Recombinant Human Hepatocyte Cell Adhesion Molecule, HepaCAM (C-6His)
Quantity: 50 μg
Other quantities: 1 mg 2283€ 50 µg 496€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: present in lysates used as reference for ELISA quantification of these molecules and their subunits, Whole adhesion and interacting molecules are 
Molecular Weight: 09 kD, 24
UniProt number: Q14CZ8
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: VNITSPVRLIHGTVGKSALLSVQYSSTSSDRPVVKWQLKRDKPVTVVQSIGTEVIGTLRPDYRDRIRLFENGSLLLSDLQLADEGTYEVEISITDDTFTGEKTINLTVDVPISRPQVLVASTTVLELSEAFTLNCSHENGTKPSYTWLKDGKPLLNDSRMLLSPDQKVLTITRVLMEDDDLYSCMVENPISQGRSLPVKITVYRRSSVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: HepaCAM (C-6His), Hepatocyte Adhesion Molecule
Short name: HepaCAM (C-6His), Recombinant Hepatocyte Cell Adhesion Molecule
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: hepatic and glial cellular adhesion molecule (C-6His), sapiens Hepatocyte cellular Adhesion Molecule, recombinant H
Alternative technique: rec

Related Products :

C522 Recombinant Human Hepatocyte Cell Adhesion Molecule, HepaCAM (C-6His) 10 µg 202 € novo human
GENTAUR-58b868e28a72a Bovine Hepatocyte cell adhesion molecule (HEPACAM) 100ug 1630 € MBS Recombinant Proteins bovine
GENTAUR-58b868e309b84 Bovine Hepatocyte cell adhesion molecule (HEPACAM) 1000ug 1630 € MBS Recombinant Proteins bovine
GENTAUR-58b868e36e5db Bovine Hepatocyte cell adhesion molecule (HEPACAM) 100ug 2144 € MBS Recombinant Proteins bovine
GENTAUR-58b868e3e8e5e Bovine Hepatocyte cell adhesion molecule (HEPACAM) 1000ug 2144 € MBS Recombinant Proteins bovine
MBS620389 Hepatocyte Cell Adhesion Molecule (HepaCAM) Antibody 100ug 774 € MBS Polyclonals_1 human
C435 Recombinant Human Cell Adhesion Molecule 3, CADM3, IGSF4B, SynCAM3 (C-6His) 500 µg 1613 € novo human
C341 Recombinant Human Endothelial Cell Adhesion Molecule, ESAM (C-6His) 50 µg 263 € novo human
CP45 Recombinant Human Neural Cell Adhesion Molecule 1, NCAM-1, CD56 (C-6His) 1 mg 2283 € novo human
CS74 Recombinant Human Platelet Endothelial Cell Adhesion Molecule, PECAM-1, CD31 (C-6His) 50 µg 202 € novo human
C427 Recombinant Human Adipocyte Adhesion Molecule, ASAM, CLMP, ACAM (C-6His) 50 µg 273 € novo human
C322 Recombinant Human Intercellular Adhesion Molecule 1, ICAM-1, CD54 (C-6His) 500 µg 1613 € novo human
C306 Recombinant Human Intercellular Adhesion Molecule 2, ICAM-2, CD102 (C-6His) 1 mg 2283 € novo human
C468 Recombinant Human Junctional Adhesion Molecule A, JAM-A, CD321 (C-6His) 50 µg 369 € novo human
C359 Recombinant Human Junctional Adhesion Molecule B, JAM-B, CD322 (C-6His) 50 µg 263 € novo human
RP-840 Recombinant (E.Coli, His-tag) Human Vascular cell adhesion molecule 1 10 μg 333 € adi human
CD29 Recombinant Human Endothelial Cell Adhesion Molecule, ESAM (C-Fc) 10 µg 146 € novo human
RP-0660H Recombinant Human ESAM / Endothelial Cell Adhesion Molecule Protein 50μg 624 € adv human
RP-0659H Recombinant Human ESAM / Endothelial Cell Adhesion Molecule Protein (Fc Tag) 50μg 624 € adv human
RP-0658H Recombinant Human ESAM / Endothelial Cell Adhesion Molecule Protein (His Tag) 50μg 624 € adv human
CC04 Recombinant Human Neuronal Cell Adhesion Molecule, NRCAM (C-Fc) 50 µg 303 € novo human
MBS621435 Hepatocyte Growth Factor Receptor (HGF R, c-MET, HGFAC, HGF activator Hepatocyte growth factor activator precursor, HGFA, HGFAP, MGC138395, MGC138397) 100ug 774 € MBS Polyclonals_1 human
abx168018 Anti-Activated Leukocyte Cell Adhesion Molecule Protein (Recombinant) 100 μg 949 € abbex human
abx166711 Anti-Basal Cell Adhesion Molecule Protein (Recombinant) 10 μg 398 € abbex human
abx261941 Anti-Carcinoembryonic Antigen-Related Cell Adhesion Molecule 21 Protein (Recombinant) 20 µg 340 € abbex human
abx166856 Anti-Carcinoembryonic Antigen Related Cell Adhesion Molecule 6 Protein (Recombinant) 100 μg 847 € abbex human
abx262619 Anti-Carcinoembryonic Antigen-Related Cell Adhesion Molecule 7 Protein (Recombinant) 2 µg 238 € abbex human
abx168190 Anti-Cell Adhesion Molecule 1 Protein (Recombinant) 50 μg 601 € abbex human
abx166901 Anti-Cell Adhesion Molecule With Homology To L1CAM Protein (Recombinant) 100 μg 847 € abbex human
abx167594 Anti-Endothelial Cell Adhesion Molecule Protein (Recombinant) 50 μg 615 € abbex human