| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
present in lysates used as reference for ELISA quantification of these molecules and their subunits, Whole adhesion and interacting molecules are |
| Molecular Weight: |
50, 8 kD |
| UniProt number: |
Q96AP7 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
QLQLHLPANRLQAVEGGEVVLPAWYTLHGEVSSSQPWEVPFVMWFFKQKEKEDQVLSYINGVTTSKPGVSLVYSMPSRNLSLRLEGLQEKDSGPYSCSVNVQDKQGKSRGHSIKTLELNVLVPPAPPSCRLQGVPHVGANVTLSCQSPRSKPAVQYQWDRQLPSFQTFFAPALDVIRGSLSLTNLSSSMAGVYVCKAHNEVGTAQCNVTLEVSTGPGAVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
ESAM (C-Fc), Endothelial Adhesion Molecule |
| Short name: |
ESAM (C-Fc), Recombinant Endothelial Cell Adhesion Molecule |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
endothelial cell adhesion molecule (C-fragment c), sapiens Endothelial cellular Adhesion Molecule, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
BT, Cell surfaces, ESAM and IDBG-75276 and ENSG00000149564 and 90952, Esam and IDBG-150411 and ENSMUSG00000001946 and 69524, protein binding, this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0005912 and adherens junction and cellular component this GO :0005923 and tight junction and cellular component this GO :0007156 and homophilic cell adhesion and biological process this GO :0007596 and blood coagulation and biological process this GO :0016021 and integral component of membrane and cellular component this GO :0016337 and single organismal cell-cell adhesion and biological process this GO :0050900 and leukocyte migration and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0005515 : protein binding, this GO :0005515 : protein binding, 54007 and IDBG-642621 and ENSBTAG00000001004 and 616926, endothelial cell adhesion molecule |
| Identity: |
17474 |
| Gene: |
ESAM |
More about : ESAM |
| Long gene name: |
endothelial cell adhesion molecule |
| Synonyms: |
W117m |
| Locus: |
11q24, 2 |
| Discovery year: |
2003-11-26 |
| GenBank acession: |
AK075396 |
| Entrez gene record: |
90952 |
| Pubmed identfication: |
11279107 11906820 |
| RefSeq identity: |
NM_138961 |
| Classification: |
Immunoglobulin like domain containing V-set domain containing |
| Havana BLAST/BLAT: |
OTTHUMG00000151986 |