Recombinant Human Cell Adhesion Molecule 3, CADM3, IGSF4B, SynCAM3 (C-6His)

Contact us
Catalog number: C435
Price: 847 €
Supplier: abbex
Product name: Recombinant Human Cell Adhesion Molecule 3, CADM3, IGSF4B, SynCAM3 (C-6His)
Quantity: 100 μg
Other quantities: 10 µg 121€ 50 µg 263€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: present in lysates used as reference for ELISA quantification of these molecules and their subunits, Whole adhesion and interacting molecules are 
Molecular Weight: 34, 68 kD
UniProt number: Q8N126
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: NLSQDDSQPWTSDETVVAGGTVVLKCQVKDHEDSSLQWSNPAQQTLYFGEKRALRDNRIQLVTSTPHELSISISNVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKPIITGYKSSLREKDTATLNCQSSGSKPAARLTWRKGDQELHGEPTRIQEDPNGKTFTVSSSVTFQVTREDDGASIVCSVNHESLKGADRSTSQRIEVLYTPTAMIRPDPPHPREGQKLLLHCEGRGNPVPQQYLWEKEGSVPPLKMTQESALIFPFLNKSDSGTYGCTATSNMGSYKAYYTLNVNDPSPVPSSSSTYHVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: CADM3, IGSF4B, SynCAM3 (C-6His), Adhesion Molecule 3
Short name: CADM3, IGSF4B, SynCAM3 (C-6His), Recombinant Cell Adhesion Molecule 3
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: IGSF4B, SynCAM3 (C-6His), cellular adhesion molecule 3, sapiens cellular Adhesion Molecule 3, recombinant H
Alternative technique: rec
Alternative to gene target: CADM3 and IDBG-103868 and ENSG00000162706 and 57863, CADM3 and IDBG-630783 and ENSBTAG00000003217 and 531178, Cadm3 and IDBG-205840 and ENSMUSG00000005338 and 94332, Cell surfaces, protein homodimerization activity, this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0005911 and cell-cell junction and cellular component this GO :0007156 and homophilic cell adhesion and biological process this GO :0007157 and heterophilic cell-cell adhesion and biological process this GO :0008104 and protein localization and biological process this GO :0016021 and integral component of membrane and cellular component this GO :0034329 and cell junction assembly and biological process this GO :0034332 and adherens junction organization and biological process this GO :0042803 and protein homodimerization activity and molecular function this GO :0045216 and cell-cell junction organization and biological process, this GO :0005515 : protein binding, this GO :0005515 : protein binding and also this GO :0042803 : protein homodimerization activity, this GO :0042803 : protein homodimerization activity, cell adhesion molecule 3
Identity: 17601
Gene: CADM3 | More about : CADM3
Long gene name: cell adhesion molecule 3
Synonyms gene: IGSF4B
Synonyms gene name: immunoglobulin superfamily, member 4B
Synonyms: BIgR FLJ10698 TSLL1 NECL1 SynCAM3 Necl-1
Synonyms name: nectin-like 1
Locus: 1q23, 2
Discovery year: 2004-02-24
GenBank acession: AY046418
Entrez gene record: 57863
Pubmed identfication: 11536053
RefSeq identity: NM_021189
Classification: C2-set domain containing Immunoglobulin like domain containing V-set domain containing
Havana BLAST/BLAT: OTTHUMG00000037177

Related Products :

C435 Recombinant Human Cell Adhesion Molecule 3, CADM3, IGSF4B, SynCAM3 (C-6His) 500 µg 1613 € novo human
RP-0174H Recombinant Human CADM3 / NECL1 / IGSF4B Protein (His Tag) 50μg 624 € adv human
RP-1059M Recombinant Mouse CADM3 / NECL1 / IGSF4B Protein (His Tag) 50μg 624 € adv mouse
RP-2021R Recombinant Rat CADM3 / NECL1 / IGSF4B Protein (Fc Tag) 50μg 624 € adv rat
RP-2022R Recombinant Rat CADM3 / NECL1 / IGSF4B Protein (His Tag) 50μg 624 € adv rat
MBS618226 DARC, CT (Duffy Antigen, Fy Glycoprotein, GpFy, Cell Adhesion Molecule 3, CADM3) Antibody 100ug 569 € MBS Polyclonals_1 human
GENTAUR-58be304ae8230 DARC (Duffy Antigen, Fy Glycoprotein, GpFy, Cell Adhesion Molecule 3, CADM3) (APC) 100 Tests 757 € MBS mono human
GENTAUR-58be304b3dce1 DARC (Duffy Antigen, Fy Glycoprotein, GpFy, Cell Adhesion Molecule 3, CADM3) (APC) Antibody 100 Tests 757 € MBS mono human
C341 Recombinant Human Endothelial Cell Adhesion Molecule, ESAM (C-6His) 50 µg 263 € novo human
C522 Recombinant Human Hepatocyte Cell Adhesion Molecule, HepaCAM (C-6His) 10 µg 202 € novo human
CP45 Recombinant Human Neural Cell Adhesion Molecule 1, NCAM-1, CD56 (C-6His) 1 mg 2283 € novo human
CS74 Recombinant Human Platelet Endothelial Cell Adhesion Molecule, PECAM-1, CD31 (C-6His) 50 µg 202 € novo human
C427 Recombinant Human Adipocyte Adhesion Molecule, ASAM, CLMP, ACAM (C-6His) 50 µg 273 € novo human
C322 Recombinant Human Intercellular Adhesion Molecule 1, ICAM-1, CD54 (C-6His) 500 µg 1613 € novo human
C306 Recombinant Human Intercellular Adhesion Molecule 2, ICAM-2, CD102 (C-6His) 1 mg 2283 € novo human
C468 Recombinant Human Junctional Adhesion Molecule A, JAM-A, CD321 (C-6His) 50 µg 369 € novo human
C359 Recombinant Human Junctional Adhesion Molecule B, JAM-B, CD322 (C-6His) 50 µg 263 € novo human
RP-840 Recombinant (E.Coli, His-tag) Human Vascular cell adhesion molecule 1 10 μg 333 € adi human
CD29 Recombinant Human Endothelial Cell Adhesion Molecule, ESAM (C-Fc) 10 µg 146 € novo human
RP-0660H Recombinant Human ESAM / Endothelial Cell Adhesion Molecule Protein 50μg 624 € adv human
RP-0659H Recombinant Human ESAM / Endothelial Cell Adhesion Molecule Protein (Fc Tag) 50μg 624 € adv human
RP-0658H Recombinant Human ESAM / Endothelial Cell Adhesion Molecule Protein (His Tag) 50μg 624 € adv human
CC04 Recombinant Human Neuronal Cell Adhesion Molecule, NRCAM (C-Fc) 50 µg 303 € novo human
abx168018 Anti-Activated Leukocyte Cell Adhesion Molecule Protein (Recombinant) 100 μg 949 € abbex human
abx166711 Anti-Basal Cell Adhesion Molecule Protein (Recombinant) 10 μg 398 € abbex human
abx261941 Anti-Carcinoembryonic Antigen-Related Cell Adhesion Molecule 21 Protein (Recombinant) 20 µg 340 € abbex human
abx166856 Anti-Carcinoembryonic Antigen Related Cell Adhesion Molecule 6 Protein (Recombinant) 100 μg 847 € abbex human
abx262619 Anti-Carcinoembryonic Antigen-Related Cell Adhesion Molecule 7 Protein (Recombinant) 2 µg 238 € abbex human
abx168190 Anti-Cell Adhesion Molecule 1 Protein (Recombinant) 50 μg 601 € abbex human
abx166901 Anti-Cell Adhesion Molecule With Homology To L1CAM Protein (Recombinant) 100 μg 847 € abbex human