| Reacts with: |
Rat |
| Source: |
proteins, Recombinants or rec |
| Description: |
chemokine receptors, ligands , motif chemokines and cytokines are supplied by novo in 1, Chemokines |
| Molecular Weight: |
10 kD |
| UniProt number: |
P50231 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
2 mM EDTA, 500 mM sodium chloride, pH7, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MNHKVHHHHHHMDDDDKSPYGSDTTPCCFAYLSLALPRAHVKEYFYTSSKCSNLAVVFVTRRNRQVCANPEKKWVQEYINYLEMS |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| About: |
Rats , There are less rat- than mouse clones however, Rats are used to make rat monoclonal anti mouse antibodies, Rattus norvegicus are often studied in vivo as a model of human genes in Sprague-Dawley or Wistar rats, genes from rodents , of the genus |
| Latin name: |
Rattus norvegicus |
| Group: |
recombinants |
| Gene target: |
CCL5 (N-6His), C-C Motif Chemokine 5 |
| Short name: |
CCL5 (N-6His), Recombinant C-C Motif Chemokine 5 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Host: |
Rat |
| Species: |
Rats, Rat |
| Alternative name: |
CCL5 (N-6His), recombinant Rat C-C Motif Chemokine 5 |
| Alternative technique: |
rec |
| Identity: |
10632 |
| Gene: |
CCL5 |
More about : CCL5 |
| Long gene name: |
C-C motif chemokine ligand 5 |
| Synonyms gene: |
D17S136E SCYA5 |
| Synonyms gene name: |
small inducible cytokine A5 (RANTES) chemokine (C-C motif) ligand 5 |
| Synonyms: |
RANTES SISd TCP228 MGC17164 |
| Synonyms name: |
T-cell specific protein p288 T-cell specific RANTES protein SIS-delta regulated upon activation, and presumably secreted beta-chemokine RANTES small inducible cytokine subfamily A (Cys-Cys), member 5 , normally T-expressed |
| Locus: |
17q12 |
| Discovery year: |
1990-07-05 |
| GenBank acession: |
AF043341 |
| Entrez gene record: |
6352 |
| Pubmed identfication: |
1691736 |
| RefSeq identity: |
NM_002985 |
| Classification: |
Endogenous ligands Chemokine ligands |
| Havana BLAST/BLAT: |
OTTHUMG00000188396 |