Recombinant Rat C-C Motif Chemokine 5, CCL5 (N-6His)

Contact us
Catalog number: CE79
Price: 671 €
Supplier: abebio
Product name: Recombinant Rat C-C Motif Chemokine 5, CCL5 (N-6His)
Quantity: 1x plate of 96 wells
Other quantities: 1 mg 1674€ 50 µg 303€ 500 µg 1186€
Related search:

More details :

Reacts with: Rat
Source: proteins, Recombinants or rec
Description: chemokine receptors, ligands , motif chemokines and cytokines are supplied by novo in 1, Chemokines
Molecular Weight: 10 kD
UniProt number: P50231
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 2 mM EDTA, 500 mM sodium chloride, pH7, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MNHKVHHHHHHMDDDDKSPYGSDTTPCCFAYLSLALPRAHVKEYFYTSSKCSNLAVVFVTRRNRQVCANPEKKWVQEYINYLEMS
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
About: Rats , There are less rat- than mouse clones however, Rats are used to make rat monoclonal anti mouse antibodies, Rattus norvegicus are often studied in vivo as a model of human genes in Sprague-Dawley or Wistar rats, genes from rodents , of the genus 
Latin name: Rattus norvegicus
Group: recombinants
Gene target: CCL5 (N-6His), C-C Motif Chemokine 5
Short name: CCL5 (N-6His), Recombinant C-C Motif Chemokine 5
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Host: Rat
Species: Rats, Rat
Alternative name: CCL5 (N-6His), recombinant Rat C-C Motif Chemokine 5
Alternative technique: rec
Identity: 10632
Gene: CCL5 | More about : CCL5
Long gene name: C-C motif chemokine ligand 5
Synonyms gene: D17S136E SCYA5
Synonyms gene name: small inducible cytokine A5 (RANTES) chemokine (C-C motif) ligand 5
Synonyms: RANTES SISd TCP228 MGC17164
Synonyms name: T-cell specific protein p288 T-cell specific RANTES protein SIS-delta regulated upon activation, and presumably secreted beta-chemokine RANTES small inducible cytokine subfamily A (Cys-Cys), member 5 , normally T-expressed
Locus: 17q12
Discovery year: 1990-07-05
GenBank acession: AF043341
Entrez gene record: 6352
Pubmed identfication: 1691736
RefSeq identity: NM_002985
Classification: Endogenous ligands Chemokine ligands
Havana BLAST/BLAT: OTTHUMG00000188396

Related Products :

CE79 Recombinant Rat C-C Motif Chemokine 5, CCL5 (N-6His) 1 mg 1674 € novo rat
MBS621737 CCL14, aa1-16 (Chemokine (C-C motif) ligand 14, CC-1, CC-3, C-C motif chemokine 14, Chemokine CC-1/CC-3, CKb1, FLJ16015, HCC-1, HCC-1/HCC-3, HCC-1(1-74), HCC-3, MCIF, NCC2, NCC-2, SCYA14, SCYL2, Small-inducible cytokine A14, SY14) Antibody 100ul 1089 € MBS Polyclonals_1 human
MBS621594 CCL14, aa21-35 (Chemokine (C-C motif) ligand 14, CC-1, CC-3, C-C motif chemokine 14, Chemokine CC-1/CC-3, CKb1, FLJ16015, HCC-1, HCC-1/HCC-3, HCC-1(1-74), HCC-3, MCIF, NCC2, NCC-2, SCYA14, SCYL2, Small-inducible cytokine A14, SY14) Antibody 100ul 1089 € MBS Polyclonals_1 human
MBS621551 CCL14, aa44-55 (Chemokine (C-C motif) ligand 14, CC-1, CC-3, C-C motif chemokine 14, Chemokine CC-1/CC-3, CKb1, FLJ16015, HCC-1, HCC-1/HCC-3, HCC-1(1-74), HCC-3, MCIF, NCC2, NCC-2, SCYA14, SCYL2, Small-inducible cytokine A14, SY14) Antibody 100ul 1089 € MBS Polyclonals_1 human
MBS621623 CCL14, aa62-74 (Chemokine (C-C motif) ligand 14, CC-1, CC-3, C-C motif chemokine 14, Chemokine CC-1/CC-3, CKb1, FLJ16015, HCC-1, HCC-1/HCC-3, HCC-1(1-74), HCC-3, MCIF, NCC2, NCC-2, SCYA14, SCYL2, Small-inducible cytokine A14, SY14) Antibody 20ul 509 € MBS Polyclonals_1 human
MBS622517 CCL14, aa8-15 (Chemokine (C-C motif) ligand 14, CC-1, CC-3, C-C motif chemokine 14, Chemokine CC-1/CC-3, CKb1, FLJ16015, HCC-1, HCC-1/HCC-3, HCC-1(1-74), HCC-3, MCIF, NCC2, NCC-2, SCYA14, SCYL2, Small-inducible cytokine A14, SY14) Antibody 100ul 1089 € MBS Polyclonals_1 human
CJ28 Recombinant Human C-C Motif Chemokine 5, CCL5, RANTES (C-Fc-6His) 1 mg 2486 € novo human
C062 Recombinant Human C-C Motif Chemokine 5, CCL5, RANTES 10 µg 168 € novo human
MBS624336 CX3CR1, EL (Beta Chemokine Receptor-like 1, CCRL1, Chemokine C-X3-C Motif Receptor 1, CX3C Chemokine Receptor 1, C-X3-C CKR-1, CX3C CKR-1, CMK-BRL-1, CMKBLR1, CMKDR1, Fractalkine Receptor, GPR13, GPRV28, V28) Antibody 100ug 569 € MBS Polyclonals_1 human
MBS624136 CX3CR1, NT (Beta Chemokine Receptor-like 1, CCRL1, Chemokine C-X3-C Motif Receptor 1, CX3C Chemokine Receptor 1, C-X3-C CKR-1, CX3C CKR-1, CMK-BRL-1, CMKBLR1, CMKDR1, Fractalkine Receptor, GPR13, GPRV28, V28) Antibody 100ug 569 € MBS Polyclonals_1 human
MBS624063 Macrophage, Monocyte Chemotactic Protein-1 (CCL2, Chemokine (C-C motif) ligand 2, C-C motif chemokine 2, GDCF-2, HC11, HSMCR30, MCAF, MCP1, MCP-1, MGC9434, Monocyte chemoattractant protein 1, Monocyte chemotactic and activating factor, Monocyte chemotacti Antibody 100ug 763 € MBS Polyclonals_1 human
MBS622737 TRIM14 (Tripartite Motif Containing 14, Tripartite Motif-containing 14, Tripartite Motif Protein 14, Tripartite Motif Protein TRIM14, TRIM 14, 5830400N10Rik, KIAA0129) 100ug 696 € MBS Polyclonals_1 human
MBS619508 TRIM4 (Tripartite Motif Containing 4, Tripartite Motif-containing 4, Tripartite Motif Protein 4, Tripartite Motif Protein TRIM4, Ring Finger Protein 87, RNF87) Antibody 100ug 735 € MBS Polyclonals_1 human
MBS620811 TRIM5 (Tripartite Motif Containing 5, Tripartite Motif-containing 5, Tripartite Motif Protein 5, Tripartite Motif Protein TRIM5, RING Finger Protein 88, RNF88) Antibody 100ug 735 € MBS Polyclonals_1 human
GENTAUR-58bb68c40c894 Bovine C-C motif chemokine 5 (CCL5) 100ug 1282 € MBS Recombinant Proteins bovine
GENTAUR-58bb68c4613a9 Bovine C-C motif chemokine 5 (CCL5) 1000ug 1282 € MBS Recombinant Proteins bovine
GENTAUR-58bb68c4afe24 Bovine C-C motif chemokine 5 (CCL5) 100ug 1790 € MBS Recombinant Proteins bovine
GENTAUR-58bb68c4f2975 Bovine C-C motif chemokine 5 (CCL5) 1000ug 1790 € MBS Recombinant Proteins bovine
EKC01057 C-C motif chemokine 5 (CCL5/D17S136E/SCYA5) ELISA kit 1 plate of 96 wells 656 € Biomatik ELISA kits human
EKC01055 C-C motif chemokine 5 (CCL5) ELISA kit 1 plate of 96 wells 596 € Biomatik ELISA kits human
EKC01056 C-C motif chemokine 5 (CCL5) ELISA kit 1 plate of 96 wells 596 € Biomatik ELISA kits human
AE51715CA Cat C-C motif chemokine 5 (CCL5) ELISA Kit 48 wells plate 500 € ab-elisa elisas cat
AE51715CA-96 Cat C-C motif chemokine 5 (CCL5) ELISA Kit 1x plate of 96 wells 671 € abebio cat
GWB-F25D76 Chemokine (C-C Motif) Ligand 5 (CCL5) Mouse antibody to or anti-Human Monoclonal (8.PP.11) antibody 1 vial 602 € genways human
AE51715CA-48 ELISA test for Cat C-C motif chemokine 5 (CCL5) 1x plate of 48 wells 402 € abebio cat
AE51713GU-48 ELISA test for Guinea pig C-C motif chemokine 5 (CCL5) 1x plate of 48 wells 402 € abebio human
AE51712HO-48 ELISA test for Horse C-C motif chemokine 5 (CCL5) 1x plate of 48 wells 402 € abebio horse
AE51711HU-48 ELISA test for Human C-C motif chemokine 5 (CCL5) 1x plate of 48 wells 402 € abebio human
AE51713GU Guinea pig C-C motif chemokine 5 (CCL5) ELISA Kit 96 wells plate 810 € ab-elisa elisas human
AE51713GU-96 Guinea pig C-C motif chemokine 5 (CCL5) ELISA Kit 1x plate of 96 wells 671 € abebio human