Recombinant Human C-C Motif Chemokine 5, CCL5, RANTES

Contact us
Catalog number: C062
Price: 402 €
Supplier: abebio
Product name: Recombinant Human C-C Motif Chemokine 5, CCL5, RANTES
Quantity: 1x plate of 48 wells
Other quantities: 1 mg 2283€ 50 µg 405€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: chemokine receptors, ligands , motif chemokines and cytokines are supplied by novo in 1, Chemokines
Molecular Weight: 7, 8 kD
UniProt number: P13501
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: CCL5, RANTES, C-C Motif Chemokine 5
Short name: CCL5, RANTES, Recombinant C-C Motif Chemokine 5
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: CCL5, RANTES, sapiens C-C Motif Chemokine 5, recombinant H
Alternative technique: rec
Identity: 10632
Gene: CCL5 | More about : CCL5
Long gene name: C-C motif chemokine ligand 5
Synonyms gene: D17S136E SCYA5
Synonyms gene name: small inducible cytokine A5 (RANTES) chemokine (C-C motif) ligand 5
Synonyms: RANTES SISd TCP228 MGC17164
Synonyms name: T-cell specific protein p288 T-cell specific RANTES protein SIS-delta regulated upon activation, and presumably secreted beta-chemokine RANTES small inducible cytokine subfamily A (Cys-Cys), member 5 , normally T-expressed
Locus: 17q12
Discovery year: 1990-07-05
GenBank acession: AF043341
Entrez gene record: 6352
Pubmed identfication: 1691736
RefSeq identity: NM_002985
Classification: Endogenous ligands Chemokine ligands
Havana BLAST/BLAT: OTTHUMG00000188396

Related Products :

C062 Recombinant Human C-C Motif Chemokine 5, CCL5, RANTES 10 µg 168 € novo human
CJ28 Recombinant Human C-C Motif Chemokine 5, CCL5, RANTES (C-Fc-6His) 1 mg 2486 € novo human
MBS621737 CCL14, aa1-16 (Chemokine (C-C motif) ligand 14, CC-1, CC-3, C-C motif chemokine 14, Chemokine CC-1/CC-3, CKb1, FLJ16015, HCC-1, HCC-1/HCC-3, HCC-1(1-74), HCC-3, MCIF, NCC2, NCC-2, SCYA14, SCYL2, Small-inducible cytokine A14, SY14) Antibody 100ul 1089 € MBS Polyclonals_1 human
MBS621594 CCL14, aa21-35 (Chemokine (C-C motif) ligand 14, CC-1, CC-3, C-C motif chemokine 14, Chemokine CC-1/CC-3, CKb1, FLJ16015, HCC-1, HCC-1/HCC-3, HCC-1(1-74), HCC-3, MCIF, NCC2, NCC-2, SCYA14, SCYL2, Small-inducible cytokine A14, SY14) Antibody 100ul 1089 € MBS Polyclonals_1 human
MBS621551 CCL14, aa44-55 (Chemokine (C-C motif) ligand 14, CC-1, CC-3, C-C motif chemokine 14, Chemokine CC-1/CC-3, CKb1, FLJ16015, HCC-1, HCC-1/HCC-3, HCC-1(1-74), HCC-3, MCIF, NCC2, NCC-2, SCYA14, SCYL2, Small-inducible cytokine A14, SY14) Antibody 100ul 1089 € MBS Polyclonals_1 human
MBS621623 CCL14, aa62-74 (Chemokine (C-C motif) ligand 14, CC-1, CC-3, C-C motif chemokine 14, Chemokine CC-1/CC-3, CKb1, FLJ16015, HCC-1, HCC-1/HCC-3, HCC-1(1-74), HCC-3, MCIF, NCC2, NCC-2, SCYA14, SCYL2, Small-inducible cytokine A14, SY14) Antibody 20ul 509 € MBS Polyclonals_1 human
MBS622517 CCL14, aa8-15 (Chemokine (C-C motif) ligand 14, CC-1, CC-3, C-C motif chemokine 14, Chemokine CC-1/CC-3, CKb1, FLJ16015, HCC-1, HCC-1/HCC-3, HCC-1(1-74), HCC-3, MCIF, NCC2, NCC-2, SCYA14, SCYL2, Small-inducible cytokine A14, SY14) Antibody 100ul 1089 € MBS Polyclonals_1 human
CE79 Recombinant Rat C-C Motif Chemokine 5, CCL5 (N-6His) 1 mg 1674 € novo rat
MBS624336 CX3CR1, EL (Beta Chemokine Receptor-like 1, CCRL1, Chemokine C-X3-C Motif Receptor 1, CX3C Chemokine Receptor 1, C-X3-C CKR-1, CX3C CKR-1, CMK-BRL-1, CMKBLR1, CMKDR1, Fractalkine Receptor, GPR13, GPRV28, V28) Antibody 100ug 569 € MBS Polyclonals_1 human
MBS624136 CX3CR1, NT (Beta Chemokine Receptor-like 1, CCRL1, Chemokine C-X3-C Motif Receptor 1, CX3C Chemokine Receptor 1, C-X3-C CKR-1, CX3C CKR-1, CMK-BRL-1, CMKBLR1, CMKDR1, Fractalkine Receptor, GPR13, GPRV28, V28) Antibody 100ug 569 € MBS Polyclonals_1 human
MBS624063 Macrophage, Monocyte Chemotactic Protein-1 (CCL2, Chemokine (C-C motif) ligand 2, C-C motif chemokine 2, GDCF-2, HC11, HSMCR30, MCAF, MCP1, MCP-1, MGC9434, Monocyte chemoattractant protein 1, Monocyte chemotactic and activating factor, Monocyte chemotacti Antibody 100ug 763 € MBS Polyclonals_1 human
MBS622737 TRIM14 (Tripartite Motif Containing 14, Tripartite Motif-containing 14, Tripartite Motif Protein 14, Tripartite Motif Protein TRIM14, TRIM 14, 5830400N10Rik, KIAA0129) 100ug 696 € MBS Polyclonals_1 human
MBS619508 TRIM4 (Tripartite Motif Containing 4, Tripartite Motif-containing 4, Tripartite Motif Protein 4, Tripartite Motif Protein TRIM4, Ring Finger Protein 87, RNF87) Antibody 100ug 735 € MBS Polyclonals_1 human
MBS620811 TRIM5 (Tripartite Motif Containing 5, Tripartite Motif-containing 5, Tripartite Motif Protein 5, Tripartite Motif Protein TRIM5, RING Finger Protein 88, RNF88) Antibody 100ug 735 € MBS Polyclonals_1 human
GWB-F25D76 Chemokine (C-C Motif) Ligand 5 (CCL5) Mouse antibody to or anti-Human Monoclonal (8.PP.11) antibody 1 vial 602 € genways human
AE51711HU-48 ELISA test for Human C-C motif chemokine 5 (CCL5) 1x plate of 48 wells 402 € abebio human
AE51711HU Human C-C motif chemokine 5 (CCL5) ELISA Kit 48 wells plate 500 € ab-elisa elisas human
AE51711HU-96 Human C-C motif chemokine 5 (CCL5) ELISA Kit 1x plate of 96 wells 671 € abebio human
GENTAUR-58bb68c40c894 Bovine C-C motif chemokine 5 (CCL5) 100ug 1282 € MBS Recombinant Proteins bovine
GENTAUR-58bb68c4613a9 Bovine C-C motif chemokine 5 (CCL5) 1000ug 1282 € MBS Recombinant Proteins bovine
GENTAUR-58bb68c4afe24 Bovine C-C motif chemokine 5 (CCL5) 100ug 1790 € MBS Recombinant Proteins bovine
GENTAUR-58bb68c4f2975 Bovine C-C motif chemokine 5 (CCL5) 1000ug 1790 € MBS Recombinant Proteins bovine
EKC01057 C-C motif chemokine 5 (CCL5/D17S136E/SCYA5) ELISA kit 1 plate of 96 wells 656 € Biomatik ELISA kits human
EKC01055 C-C motif chemokine 5 (CCL5) ELISA kit 1 plate of 96 wells 596 € Biomatik ELISA kits human
EKC01056 C-C motif chemokine 5 (CCL5) ELISA kit 1 plate of 96 wells 596 € Biomatik ELISA kits human
AE51715CA Cat C-C motif chemokine 5 (CCL5) ELISA Kit 48 wells plate 500 € ab-elisa elisas cat
AE51715CA-96 Cat C-C motif chemokine 5 (CCL5) ELISA Kit 1x plate of 96 wells 671 € abebio cat
AE51715CA-48 ELISA test for Cat C-C motif chemokine 5 (CCL5) 1x plate of 48 wells 402 € abebio cat
AE51713GU-48 ELISA test for Guinea pig C-C motif chemokine 5 (CCL5) 1x plate of 48 wells 402 € abebio human
AE51712HO-48 ELISA test for Horse C-C motif chemokine 5 (CCL5) 1x plate of 48 wells 402 € abebio horse