| Reacts with: |
Mouse |
| Source: |
proteins, Recombinants or rec |
| Description: |
Alpha-2-Antiplasmin (C-6His) is a &alpha, - or alpha protein sometimes glycoprotein present in blood, The Recombinant Mouse Serpin F2 |
| Molecular Weight: |
2 kD, 53 |
| UniProt number: |
Q61247 |
| State of the product: |
Liquid |
| Shipping conditions: |
Dry ice/ice packs |
| Formulation: |
0(20% glycerol, 1 mM DTT), 150 mM sodium chloride, 2 um filtered solution of 20 mM Tris, Supplied as a 0, pH 8 |
| Storage recommendations: |
-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
VDLPGQQPVSEQAQQKLPLPALFKLDNQDFGDHATLKRSPGHCKSVPTAEETRRLAQAMMAFTTDLFSLVAQTSTSSNLVLSPLSVALALSHLALGAQNQTLHSLHRVLHMNTGSCLPHLLSHFYQNLGPGTIRLAARIYLQKGFPIKDDFLEQSERLFGAKPVKLTGKQEEDLANINQWVKEATEGKIEDFLSELPDSTVLLLLNAIHFHGFWRTKFDPSLTQKDFFHLDERFTVSVDMMHAVSYPLRWFLLEQPEIQVAHFPFKNNMSFVVVMPTYFEWNVSEVLANLTWDTLYHPSLQERPTKVWLPKLHLQQQLDLVATLSQLGLQELFQGPDLRGISEQNLVVSSVQHQSTMELSEAGVEAAAATSVAMNRMSLSSFTVNRPFLFFIMEDTIGVPLFVGSVRNPNPSALPQLQEQRDSPDNRLIGQNDKADFHGGKTFGPDLKLAPRMEEDYPQFSSPKVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Test: |
A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or  |
| Latin name: |
Mus musculus |
| Group: |
recombinants |
| Gene target: |
Alpha-2-Antiplasmin (C-6His), Serpin F2 |
| Short name: |
Alpha-2-Antiplasmin (C-6His), Recombinant Mouse Serpin F2 |
| Technique: |
E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Mouses, Mouse |
| Alternative name: |
a-2-Antiplasmin (C-6His), recombinant Mouse Serpin coagulation factor II (thrombin) |
| Alternative technique: |
rec |
| Alternative to gene target: |
Extracellular, F2 and IDBG-191373 and ENSMUSG00000027249 and 14061, F2 and IDBG-42048 and ENSG00000180210 and 2147, F2 and IDBG-637247 and ENSBTAG00000007148 and 280685, PT and RPRGL2 and THPH1, intrinsic pathway and biological process this GO :0008083 and growth factor activity and molecular function this GO :0008233 and peptidase activity and molecular function this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0008360 and regulation of cell shape and biological process this GO :0009611 and response to wounding and biological process this GO :0010468 and regulation of gene expression and biological process this GO :0010544 and negative regulation of platelet activation and biological process this GO :0014068 and positive regulation of phosphatidylinositol 3-kinase signaling and biological process this GO :0017187 and peptidyl-glutamic acid carboxylation and biological process this GO :0030168 and platelet activation and biological process this GO :0030193 and regulation of blood coagulation and biological process this GO :0030194 and positive regulation of blood coagulation and biological process this GO :0030307 and positive regulation of cell growth and biological process this GO :0032967 and positive regulation of collagen biosynthetic process and biological process this GO :0042730 and fibrinolysis and biological process this GO :0043687 and post-translational protein modification and biological process this GO :0044267 and cellular protein metabolic process and biological process this GO :0045861 and negative regulation of proteolysis and biological process this GO :0048712 and negative regulation of astrocyte differentiation and biological process this GO :0050900 and leukocyte migration and biological process this GO :0051281 and positive regulation of release of sequestered calcium ion into cytosol and biological process this GO :0051480 and cytosolic calcium ion homeostasis and biological process this GO :0051918 and negative regulation of fibrinolysis and biological process this GO :0070053 and thrombospondin receptor activity and molecular function this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0072562 and blood microparticle and cellular component this GO :1900738 and positive regulation of phospholipase C-activating G-protein coupled receptor signaling pathway and biological process this GO :2000379 and positive regulation of reactive oxygen species metabolic process and biological process, this GO :0001934 and positive regulation of protein phosphorylation and biological process this GO :0003824 and catalytic activity and molecular function this GO :0004252 and serine-type endopeptidase activity and molecular function this GO :0005102 and receptor binding and molecular function this GO :0005509 and calcium ion binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005788 and endoplasmic reticulum lumen and cellular component this GO :0005796 and this GO lgi lumen and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006508 and proteolysis and biological process this GO :0006953 and acute-phase response and biological process this GO :0007166 and cell surface receptor signaling pathway and biological process this GO :0007275 and multicellular organismal development and biological process this GO :0007596 and blood coagulation and biological process this GO :0007597 and blood coagulation, this GO :0003824 : catalytic activity, this GO :0003824 : catalytic activity and also this GO :0004252 : serine-type endopeptidase activity and also this GO :0005102 : receptor binding and also this GO :0005509 : calcium ion binding and also this GO :0005515 : protein binding and also this GO :0008083 : growth factor activity and also this GO :0008233 : peptidase activity and also this GO :0070053 : thrombospondin receptor activity, this GO :0004252 : serine-type endopeptidase activity, this GO :0005102 : receptor binding, this GO :0005509 : calcium ion binding, this GO :0005515 : protein binding, this GO :0008083 : growth factor activity, this GO :0008233 : peptidase activity, this GO :0070053 : thrombospondin receptor activity, thrombospondin receptor activity, coagulation factor II (thrombin) |