| Reacts with: |
Mouse |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Mouse TRAIL receptor 2 is produced by our Mammalian expression system and the target gene encoding Asn53-Ser177 is expressed with a Fc tag at the C-terminus |
| Molecular Weight: |
40, 9 kD |
| UniProt number: |
Q9QZM4 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
NPAHNRPAGLQRPEESPSRGPCLAGQYLSEGNCKPCREGIDYTSHSNHSLDSCILCTVCKEDKVVETRCNITTNTVCRCKPGTFEDKDSPEICQSCSNCTDGEEELTSCTPRENRKCVSKTAWASVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Test: |
A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or |
| Latin name: |
Mus musculus |
| Group: |
recombinants |
| Gene target: |
CD262 (C-Fc), DR5, TNFRSF10B, TRAIL R2 |
| Short name: |
CD262 (C-Fc), DR5, TNFRSF10B, Recombinant Mouse TRAIL R2 |
| Technique: |
E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Mouses, Mouse |
| Alternative name: |
CD262 (C-fragment c), DR5, member 10b, tumor necrosis factor receptor superfamily, recombinant Mouse TRAIL R2 |
| Alternative technique: |
rec |
| Alternative to gene target: |
CD262 and DR5 and KILLER and KILLER/DR5 and TRAIL-R2 and TRAILR2 and TRICK2 and TRICK2A and TRICK2B and TRICKB and ZTNFR9, Plasma membranes, TNFRSF10B and IDBG-11376 and ENSG00000120889 and 8795, TRAIL binding, member 10b, this GO :0004872 and receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0006915 and apoptotic process and biological process this GO :0006919 and activation of cysteine-type endopeptidase activity involved in apoptotic process and biological process this GO :0007165 and signal transduction and biological process this GO :0007166 and cell surface receptor signaling pathway and biological process this GO :0007250 and activation of NF-kappaB-inducing kinase activity and biological process this GO :0008625 and extrinsic apoptotic signaling pathway via death domain receptors and biological process this GO :0016021 and integral component of membrane and cellular component this GO :0034976 and response to endoplasmic reticulum stress and biological process this GO :0042981 and regulation of apoptotic process and biological process this GO :0043123 and positive regulation of I-kappaB kinase/NF-kappaB signaling and biological process this GO :0045569 and TRAIL binding and molecular function this GO :0070059 and intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress and biological process this GO :0071260 and cellular response to mechanical stimulus and biological process this GO :0097190 and apoptotic signaling pathway and biological process this GO :2001239 and regulation of extrinsic apoptotic signaling pathway in absence of ligand and biological process, this GO :0004872 : receptor activity, this GO :0004872 : receptor activity and also this GO :0005515 : protein binding and also this GO :0045569 : TRAIL binding, this GO :0005515 : protein binding, this GO :0045569 : TRAIL binding, tumor necrosis factor receptor superfamily |
| Identity: |
11905 |
| Gene: |
TNFRSF10B |
More about : TNFRSF10B |
| Long gene name: |
TNF receptor superfamily member 10b |
| Synonyms gene name: |
member 10b , tumor necrosis factor receptor superfamily |
| Synonyms: |
DR5 KILLER TRICK2A TRAIL-R2 TRICKB CD262 |
| Locus: |
8p21, 3 |
| Discovery year: |
1998-12-04 |
| GenBank acession: |
AF012628 |
| Entrez gene record: |
8795 |
| Pubmed identfication: |
9285725 9311998 |
| RefSeq identity: |
NM_147187 |
| Classification: |
CD molecules Tumor necrosis factor receptor superfamily |
| Havana BLAST/BLAT: |
OTTHUMG00000097826 |