| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human TRAIL receptor 2 is produced by our Mammalian expression system and the target gene encoding Ile56-Glu182 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
15, 19 kD |
| UniProt number: |
O14763 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
ITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKEVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
CD262 (C-6His), DR5, TNFRSF10B, TRAIL R2 |
| Short name: |
CD262 (C-6His), DR5, TNFRSF10B, Recombinant TRAIL R2 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
CD262 (C-6His), DR5, member 10b, sapiens TRAIL R2, tumor necrosis factor receptor superfamily, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
CD262 and DR5 and KILLER and KILLER/DR5 and TRAIL-R2 and TRAILR2 and TRICK2 and TRICK2A and TRICK2B and TRICKB and ZTNFR9, Plasma membranes, TNFRSF10B and IDBG-11376 and ENSG00000120889 and 8795, TRAIL binding, member 10b, this GO :0004872 and receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0006915 and apoptotic process and biological process this GO :0006919 and activation of cysteine-type endopeptidase activity involved in apoptotic process and biological process this GO :0007165 and signal transduction and biological process this GO :0007166 and cell surface receptor signaling pathway and biological process this GO :0007250 and activation of NF-kappaB-inducing kinase activity and biological process this GO :0008625 and extrinsic apoptotic signaling pathway via death domain receptors and biological process this GO :0016021 and integral component of membrane and cellular component this GO :0034976 and response to endoplasmic reticulum stress and biological process this GO :0042981 and regulation of apoptotic process and biological process this GO :0043123 and positive regulation of I-kappaB kinase/NF-kappaB signaling and biological process this GO :0045569 and TRAIL binding and molecular function this GO :0070059 and intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress and biological process this GO :0071260 and cellular response to mechanical stimulus and biological process this GO :0097190 and apoptotic signaling pathway and biological process this GO :2001239 and regulation of extrinsic apoptotic signaling pathway in absence of ligand and biological process, this GO :0004872 : receptor activity, this GO :0004872 : receptor activity and also this GO :0005515 : protein binding and also this GO :0045569 : TRAIL binding, this GO :0005515 : protein binding, this GO :0045569 : TRAIL binding, tumor necrosis factor receptor superfamily |
| Identity: |
11905 |
| Gene: |
TNFRSF10B |
More about : TNFRSF10B |
| Long gene name: |
TNF receptor superfamily member 10b |
| Synonyms gene name: |
member 10b , tumor necrosis factor receptor superfamily |
| Synonyms: |
DR5 KILLER TRICK2A TRAIL-R2 TRICKB CD262 |
| Locus: |
8p21, 3 |
| Discovery year: |
1998-12-04 |
| GenBank acession: |
AF012628 |
| Entrez gene record: |
8795 |
| Pubmed identfication: |
9285725 9311998 |
| RefSeq identity: |
NM_147187 |
| Classification: |
CD molecules Tumor necrosis factor receptor superfamily |
| Havana BLAST/BLAT: |
OTTHUMG00000097826 |