Recombinant Mouse GITR, TNFRSF18, CD357 (C-Fc-6His)

Contact us
Catalog number: CD76
Price: 464 €
Supplier: MBS mono
Product name: Recombinant Mouse GITR, TNFRSF18, CD357 (C-Fc-6His)
Quantity: 0.25 miligrams
Other quantities: 1 mg 1674€ 10 µg 141€ 500 µg 1115€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: 6His tag at the C-terminus, Recombinant Mouse GITR is produced by our Mammalian expression system and the target gene encoding Ser22-His153 is expressed with a Fc
Molecular Weight: 3 kD, 42
UniProt number: O35714
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: SVVEEPGCGPGKVQNGSGNNTRCCSLYAPGKEDCPKERCICVTPEYHCGDPQCKICKHYPCQPGQRVESQGDIVFGFRCVACAMGTFSAGRDGHCRLWTNCSQFGFLTMFPGNKTHNAVCIPEPLPTEQYGHVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: CD357 (C-Fc-6His), TNFRSF18, GITR
Short name: CD357 (C-Fc-6His), TNFRSF18, Recombinant Mouse GITR
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses, Mouse
Alternative name: CD357 (C-fragment c-6His), member 18, tumor necrosis factor receptor superfamily, recombinant Mouse GITR
Alternative technique: rec
Alternative to gene target: AITR and CD357 and GITR and GITR-D, Extracellular, TNFRSF18 and IDBG-635325 and ENSBTAG00000015632 and 516256, TNFRSF18 and IDBG-84584 and ENSG00000186891 and 8784, Tnfrsf18 and IDBG-208288 and ENSMUSG00000041954 and 21936, member 18, protein binding, this GO :0005031 and tumor necrosis factor-activated receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006915 and apoptotic process and biological process this GO :0007165 and signal transduction and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0033209 and tumor necrosis factor-mediated signaling pathway and biological process this GO :0043066 and negative regulation of apoptotic process and biological process this GO :0045087 and innate immune response and biological process, this GO :0005031 : tumor necrosis factor-activated receptor activity, this GO :0005031 : tumor necrosis factor-activated receptor activity and also this GO :0005515 : protein binding, this GO :0005515 : protein binding, tumor necrosis factor receptor superfamily
Identity: 11914
Gene: TNFRSF18 | More about : TNFRSF18
Long gene name: TNF receptor superfamily member 18
Synonyms gene name: member 18 , tumor necrosis factor receptor superfamily
Synonyms: AITR GITR CD357
Locus: 1p36, 33
Discovery year: 1998-12-04
GenBank acession: AF125304
Entrez gene record: 8784
Pubmed identfication: 9177197 10037686
RefSeq identity: NM_004195
Classification: CD molecules Tumor necrosis factor receptor superfamily
Havana BLAST/BLAT: OTTHUMG00000001414

Related Products :

CD76 Recombinant Mouse GITR, TNFRSF18, CD357 (C-Fc-6His) 1 mg 1674 € novo mouse
CP23 Recombinant Human GITR, TNFRSF18, CD357 (C-Fc) 500 µg 659 € novo human
RP-0744H Recombinant Human GITR / TNFRSF18 Protein (Fc Tag) 50μg 456 € adv human
RP-2141R Recombinant Rat GITR / TNFRSF18 Protein (Fc Tag) 50μg 624 € adv rat
abx200775 Anti-GiTR (CD357) Antibody 25 μg 340 € abbex human
abx200776 Anti-GiTR (CD357) Antibody 100 μg 369 € abbex human
abx200780 Anti-GiTR (CD357) Antibody inquire 50 € abbex human
abx200782 Anti-GiTR (CD357) Antibody inquire 50 € abbex human
abx200777 Anti-GiTR (CD357) Antibody (CF-Blue) inquire 50 € abbex human
abx200778 Anti-GiTR (CD357) Antibody (FITC) 500 μg 615 € abbex human
abx200779 Anti-GiTR (CD357) Antibody (PE) 25 μg 311 € abbex human
abx200781 Anti-GiTR (CD357) Antibody (PerCP-Cy5.5) inquire 50 € abbex human
ACL8978AP GITR Ligand (GITR-L); Clone: YGL 386, Rat Mouse Monoclonal antibody-Mouse 0.2mg Ask price € accurate-monoclonals mouse
ACL8978PE GITR Ligand (GITR-L); Clone: YGL 386, Rat Mouse Monoclonal antibody-Mouse; PE 50 ug 266 € accurate-monoclonals mouse
GENTAUR-58bde7ae3baac Mouse Monoclonal [clone 2H4] (IgG2b,k) to Human TNFRSF18 / GITR Antibody 50ug 663 € MBS mono human
AR52046PU-N anti-TNFRSF18 / GITR (26-162, hIgG-His tag) Antibody 0,25 mg 1834 € acr human
AR52046PU-S anti-TNFRSF18 / GITR (26-162, hIgG-His tag) Antibody 50 Вµg 587 € acr human
AR51970PU-N anti-TNFRSF18 / GITR (26-162, His-tag) Antibody 0,25 mg 1413 € acr human
AR51970PU-S anti-TNFRSF18 / GITR (26-162, His-tag) Antibody 50 Вµg 485 € acr human
DM3549P anti-TNFRSF18 / GITR Antibody 0,1 mg 688 € acr human
SM2236P anti-TNFRSF18 / GITR Antibody 0,25 mg 659 € acr human
SM2236PS anti-TNFRSF18 / GITR Antibody 0,1 mg 514 € acr human
SM2236PT anti-TNFRSF18 / GITR Antibody 25 Вµg 297 € acr human
SM2236R anti-TNFRSF18 / GITR Antibody 100 Tests 485 € acr human
CI05 Recombinant Human GITR Ligand, TNFSF18 (C-6His) 1 mg 2283 € novo human
GWB-784245 Mouse CD357 antibody 1 tube 400 € genways mouse
GWB-B4D72E Mouse CD357 antibody 1 vial 550 € genways mouse
GWB-E2D5F4 Mouse CD357 antibody 1 vial 198 € genways mouse
GWB-5B3ACA Mouse CD357 antibody (RPE) 1 x 1 vial 498 € genways mouse
GENTAUR-58bde01bb1cc4 RAT ANTI MOUSE CD357 Antibody 0.25 miligrams 464 € MBS mono human