Recombinant Human GITR Ligand, TNFSF18 (C-6His)

Contact us
Catalog number: CI05
Price: 1109 €
Supplier: acr
Product name: Recombinant Human GITR Ligand, TNFSF18 (C-6His)
Quantity: 0,5 mg
Other quantities: 10 µg 156€ 50 µg 369€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Receptor agonists are often tested for drug development, FAS ligand and other ligands are binding to the receptor for signaling pathways for example in apoptosis or JNK signaling
Molecular Weight: 15, 3 kD
UniProt number: Q9UNG2
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH 7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: ETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFISVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: TNFSF18 (C-6His), GITR Ligand
Short name: TNFSF18 (C-6His), Recombinant GITR Ligand
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: member 18 (C-6His), sapiens GITR Ligand, tumor necrosis factor (ligand) superfamily, recombinant H
Alternative technique: rec
Alternative to gene target: AITRL and GITRL and hGITRL and TL6, Extracellular, LOC768081 and IDBG-632315 and ENSBTAG00000047412 and 768081, TNFSF18 and IDBG-104861 and ENSG00000120337 and 8995, Tnfsf18 and IDBG-201543 and ENSMUSG00000066755 and 240873, member 18, this GO :0002309 and T cell proliferation involved in immune response and biological process this GO :0005102 and receptor binding and molecular function this GO :0005125 and cytokine activity and molecular function this GO :0005164 and tumor necrosis factor receptor binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005615 and extracellular space and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006955 and immune response and biological process this GO :0007165 and signal transduction and biological process this GO :0007267 and cell-cell signaling and biological process this GO :0009986 and cell surface and cellular component this GO :0016020 and membrane and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0032813 and tumor necrosis factor receptor superfamily binding and molecular function this GO :0033209 and tumor necrosis factor-mediated signaling pathway and biological process this GO :0042129 and regulation of T cell proliferation and biological process this GO :0043066 and negative regulation of apoptotic process and biological process this GO :0051092 and positive regulation of NF-kappaB transcription factor activity and biological process, this GO :0005102 : receptor binding, this GO :0005102 : receptor binding and also this GO :0005125 : cytokine activity and also this GO :0005164 : tumor necrosis factor receptor binding and also this GO :0005515 : protein binding and also this GO :0032813 : tumor necrosis factor receptor superfamily binding, this GO :0005125 : cytokine activity, this GO :0005164 : tumor necrosis factor receptor binding, this GO :0005515 : protein binding, this GO :0032813 : tumor necrosis factor receptor superfamily binding, tumor necrosis factor receptor superfamily binding, tumor necrosis factor (ligand) superfamily
Identity: 11932
Gene: TNFSF18 | More about : TNFSF18
Long gene name: tumor necrosis factor superfamily member 18
Synonyms gene name: member 18 , tumor necrosis factor (ligand) superfamily
Synonyms: AITRL TL6 hGITRL
Locus: 1q25, 1
Discovery year: 1999-01-15
GenBank acession: AF117713
Entrez gene record: 8995
Pubmed identfication: 10037686 10074428
RefSeq identity: NM_005092
Classification: Tumor necrosis factor superfamily
Havana BLAST/BLAT: OTTHUMG00000034835

Related Products :

CI05 Recombinant Human GITR Ligand, TNFSF18 (C-6His) 1 mg 2283 € novo human
ACL8978AP GITR Ligand (GITR-L); Clone: YGL 386, Rat Mouse Monoclonal antibody-Mouse 0.2mg Ask price € accurate-monoclonals mouse
ACL8978PE GITR Ligand (GITR-L); Clone: YGL 386, Rat Mouse Monoclonal antibody-Mouse; PE 50 ug 266 € accurate-monoclonals mouse
CD76 Recombinant Mouse GITR, TNFRSF18, CD357 (C-Fc-6His) 1 mg 1674 € novo mouse
MBS612868 APRIL, ED2 (a Proliferation Inducing Ligand, TALL-2, TNF and ApoL-related Leukocyte-expressed Ligand 2, TRDL-1a, TNF-related Death Ligand 1a, TNFSF13) Antibody 100ug 569 € MBS Polyclonals_1 human
CP23 Recombinant Human GITR, TNFRSF18, CD357 (C-Fc) 500 µg 659 € novo human
RP-0744H Recombinant Human GITR / TNFRSF18 Protein (Fc Tag) 50μg 456 € adv human
GWB-P0789I TNFSF18, 72-199aa, Recombinant Protein bulk Ask price € genways bulk human
ZR-40-313 TNFSF18 Recombinant Protein 0.005 mg 256 € Zyagen human
RP-2141R Recombinant Rat GITR / TNFRSF18 Protein (Fc Tag) 50μg 624 € adv rat
CH04 Recombinant Human 4-1BB Ligand, 4-1BBL, TNFSF9, CD137L (C-6His) 500 µg 1613 € novo human
CA82 Recombinant Human Fms-Related Tyrosine Kinase 3 Ligand, FLT3LG (C-6His) 500 µg 1613 € novo human
CK78 Recombinant Human NKG2D Ligand 1, NKG2DL, ULBP1 (C-6His) 10 µg 146 € novo human
C508 Recombinant Human NKG2D Ligand 2, NKG2DL2, N2DL2 (C-6His) 10 µg 121 € novo human
CJ45 Recombinant Human OX40 Ligand, TNFSF4, OX40L (N-6His) 50 µg 496 € novo human
CD53 Recombinant Human Stem Cell Factor, SCF, c-Kit Ligand (C-6His) 10 µg 146 € novo human
CC19 Recombinant Mouse Fms-LikeTyrosine Kinase 3 Ligand, FLT3LG (C-6His) 1 mg 2283 € novo mouse
CS08 Recombinant Mouse ICOS Ligand, B7-H2, CD275 (C-6His) 1 mg 2283 € novo mouse
CJ87 Recombinant Mouse NKG2D Ligand 1, NKG2DL, ULBP1 (C-6His) 500 µg 1115 € novo mouse
101-M677 Anti-Human TNFSF18 100ug 336 € Reliatech antibodies human
abx252600 Anti-Human TNFSF18 ELISA Kit inquire 50 € abbex human
LV340661 TNFSF18 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
abx151664 Anti-Human GITR ELISA Kit 96 tests 891 € abbex human
abx575003 Anti-Human GITR ELISA Kit inquire 50 € abbex human
CEK1178 anti-Human GITR ELISA Kit Antibody 96 Tests 703 € acr human
DL-GITR-Hu Human Glucocorticoid Induced Tumor Necrosis Factor Receptor GITR ELISA Kit 96T 788 € DL elisas human
GENTAUR-58bde7ae3baac Mouse Monoclonal [clone 2H4] (IgG2b,k) to Human TNFRSF18 / GITR Antibody 50ug 663 € MBS mono human
AR51908PU-N anti-TNFSF18 / AITRL (50-177, His-tag) Antibody 0,5 mg 1109 € acr human
AR51908PU-S anti-TNFSF18 / AITRL (50-177, His-tag) Antibody 0,1 mg 485 € acr human
AR50074PU-N anti-TNFSF18 / AITRL (72-199) Antibody 0,5 mg 1109 € acr human