Recombinant Mouse Cathepsin E, CTSE (C-6His)

Contact us
Catalog number: CD28
Price: 1613 €
Supplier: novo
Product name: Recombinant Mouse Cathepsin E, CTSE (C-6His)
Quantity: 500 µg
Other quantities: 1 mg 2486€ 10 µg 202€ 50 µg 496€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: Recombinant Mouse Cathepsin E is produced by our Mammalian expression system and the target gene encoding Ser60-Pro397 is expressed with a 6His tag at the C-terminus
Molecular Weight: 37 kD
UniProt number: P70269
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: SCNVYSSVNEPLINYLDMEYFGTISIGTPPQNFTVIFDTGSSNLWVPSVYCTSPACKAHPVFHPSQSDTYTEVGNHFSIQYGTGSLTGIIGADQVSVEGLTVDGQQFGESVKEPGQTFVNAEFDGILGLGYPSLAAGGVTPVFDNMMAQNLVALPMFSVYLSSDPQGGSGSELTFGGYDPSHFSGSLNWIPVTKQAYWQIALDGIQVGDTVMFCSEGCQAIVDTGTSLITGPPDKIKQLQEAIGATPIDGEYAVDCATLDTMPNVTFLINEVSYTLNPTDYILPDLVEGMQFCGSGFQGLDIPPPAGPLWILGDVFIRQFYSVFDRGNNQVGLAPAVPVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Gene: CTSE | More about : CTSE
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: CTSE (C-6His), Cathepsin E
Short name: CTSE (C-6His), Recombinant Mouse Cathepsin E
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses, Mouse
Alternative name: cathepsin E (C-6His), recombinant Mouse Cathepsin E
Alternative technique: rec
Alternative to gene target: CATE, CTSE and IDBG-106216 and ENSG00000196188 and 1510, Ctse and IDBG-191348 and ENSMUSG00000004552 and 13034, multiple, protein homodimerization activity, this GO :0004190 and aspartic-type endopeptidase activity and molecular function this GO :0005768 and endosome and cellular component this GO :0006508 and proteolysis and biological process this GO :0007586 and digestion and biological process this GO :0016540 and protein autoprocessing and biological process this GO :0019886 and antigen processing and presentation of exogenous peptide antigen via MHC class II and biological process this GO :0042803 and protein homodimerization activity and molecular function this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0004190 : aspartic-type endopeptidase activity, this GO :0004190 : aspartic-type endopeptidase activity and also this GO :0042803 : protein homodimerization activity, this GO :0042803 : protein homodimerization activity, cathepsin E
Identity: 2530
Long gene name: cathepsin E
Locus: 1q32, 1
Discovery year: 1989-05-19
GenBank acession: BC042537
Entrez gene record: 1510
Pubmed identfication: 2369841 2674141
RefSeq identity: NM_001910
Classification: Cathepsins
Havana BLAST/BLAT: OTTHUMG00000036121

Related Products :

MBS624238 CTSE, ID (Cathepsin E, Cathepsin E form I, Cathepsin E form II) Antibody 200ul 603 € MBS Polyclonals_1 human
CD28 Recombinant Mouse Cathepsin E, CTSE (C-6His) 10 µg 202 € novo mouse
C400 Recombinant Human Cathepsin E, CTSE (C-6His) 10 µg 202 € novo human
MBS624515 CTSH, NT (Cathepsin H, Cathepsin H Mini Chain, Cathepsin H Heavy Chain, Cathepsin H Light Chain, CPSB) Antibody 200ul 603 € MBS Polyclonals_1 human
MBS624507 CTSK (ID R222) (Cathepsin K, Cathepsin O, Cathepsin X, Cathepsin O2, CTSO2, CTSO) Antibody 200ul 603 € MBS Polyclonals_1 human
RP-1079M Recombinant Mouse Cathepsin E / CTSE Protein (His Tag) 10μg 624 € adv mouse
CTSE41-N-10 Recombinant (HEK) Cathepsin E (CTSE) (20-396, full length, >95%, his-tag, low endotoxins) 10 μg 405 € adi human
RP-2025R Recombinant Rat Cathepsin E / CTSE Protein (His Tag) 10μg 624 € adv rat
AE48439MO-48 ELISA test for Mouse Cathepsin E (CTSE) 1x plate of 48 wells 373 € abebio mouse
AE48439MO-96 Mouse Cathepsin E (CTSE) ELISA Kit 1x plate of 96 wells 612 € abebio mouse
abx572440 Anti-Human Cathepsin E (CTSE) ELISA Kit 96 tests 789 € abbex human
EKU03029 Cathepsin E (CTSE) ELISA kit 1 plate of 96 wells 822 € Biomatik ELISA kits human
AE48441GU-48 ELISA test for Guinea pig Cathepsin E (CTSE) 1x plate of 48 wells 402 € abebio human
AE48441GU Guinea pig Cathepsin E (CTSE) ELISA Kit 48 wells plate 500 € ab-elisa elisas human
AE48441GU-96 Guinea pig Cathepsin E (CTSE) ELISA Kit 1x plate of 96 wells 671 € abebio human
DL-CTSE-Hu Human Cathepsin E CTSE ELISA Kit 96T 904 € DL elisas human
GENTAUR-58b9c561b294c Rat Cathepsin E (Ctse) 100ug 1973 € MBS Recombinant Proteins rat
GENTAUR-58b9c5621ab5d Rat Cathepsin E (Ctse) 1000ug 1973 € MBS Recombinant Proteins rat
GENTAUR-58b9c56270162 Rat Cathepsin E (Ctse) 100ug 2487 € MBS Recombinant Proteins rat
GENTAUR-58b9c562de98e Rat Cathepsin E (Ctse) 1000ug 2487 € MBS Recombinant Proteins rat
CJ65 Recombinant Mouse Cathepsin B, CTSB (C-6His) 50 µg 496 € novo mouse
CC21 Recombinant Mouse Cathepsin D, CSTD (C-6His) 500 µg 1755 € novo mouse
CK47 Recombinant Mouse Cathepsin H, CTSH (C-6His) 500 µg 1755 € novo mouse
CD24 Recombinant Mouse Cathepsin L, CTSL (C-6His) 50 µg 496 € novo mouse
CM37 Recombinant Mouse Cathepsin S, CTSS (C-6His) 50 µg 496 € novo mouse
RP-0227H Recombinant Human Cathepsin V / Cathepsin L2 / Preproprotein Protein (His Tag) 10μg 624 € adv human
CI11 Recombinant Human Cathepsin A, CTSA (C-6His) 500 µg 1613 € novo human
C398 Recombinant Human Cathepsin B, CTSB (C-6His) 1 mg 2283 € novo human
C399 Recombinant Human Cathepsin D, CTSD (C-6His) 50 µg 496 € novo human
C401 Recombinant Human Cathepsin L, CTSL (C-6His) 500 µg 1613 € novo human