Recombinant Mouse Serpin F2, Alpha-2-Antiplasmin (C-6His)

Contact us
Catalog number: CM08
Price: 2283 €
Supplier: novo
Product name: Recombinant Mouse Serpin F2, Alpha-2-Antiplasmin (C-6His)
Quantity: 1 mg
Other quantities: 1 mg 2486€ 50 µg 496€ 500 µg 1755€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: Alpha-2-Antiplasmin (C-6His) is a &alpha, - or alpha protein sometimes glycoprotein present in blood, The Recombinant Mouse Serpin F2
Molecular Weight: 2 kD, 53
UniProt number: Q61247
State of the product: Liquid
Shipping conditions: Dry ice/ice packs
Formulation: 0(20% glycerol, 1 mM DTT), 150 mM sodium chloride, 2 um filtered solution of 20 mM Tris, Supplied as a 0, pH 8
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: VDLPGQQPVSEQAQQKLPLPALFKLDNQDFGDHATLKRSPGHCKSVPTAEETRRLAQAMMAFTTDLFSLVAQTSTSSNLVLSPLSVALALSHLALGAQNQTLHSLHRVLHMNTGSCLPHLLSHFYQNLGPGTIRLAARIYLQKGFPIKDDFLEQSERLFGAKPVKLTGKQEEDLANINQWVKEATEGKIEDFLSELPDSTVLLLLNAIHFHGFWRTKFDPSLTQKDFFHLDERFTVSVDMMHAVSYPLRWFLLEQPEIQVAHFPFKNNMSFVVVMPTYFEWNVSEVLANLTWDTLYHPSLQERPTKVWLPKLHLQQQLDLVATLSQLGLQELFQGPDLRGISEQNLVVSSVQHQSTMELSEAGVEAAAATSVAMNRMSLSSFTVNRPFLFFIMEDTIGVPLFVGSVRNPNPSALPQLQEQRDSPDNRLIGQNDKADFHGGKTFGPDLKLAPRMEEDYPQFSSPKVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: Alpha-2-Antiplasmin (C-6His), Serpin F2
Short name: Alpha-2-Antiplasmin (C-6His), Recombinant Mouse Serpin F2
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses, Mouse
Alternative name: a-2-Antiplasmin (C-6His), recombinant Mouse Serpin coagulation factor II (thrombin)
Alternative technique: rec
Alternative to gene target: Extracellular, F2 and IDBG-191373 and ENSMUSG00000027249 and 14061, F2 and IDBG-42048 and ENSG00000180210 and 2147, F2 and IDBG-637247 and ENSBTAG00000007148 and 280685, PT and RPRGL2 and THPH1, intrinsic pathway and biological process this GO :0008083 and growth factor activity and molecular function this GO :0008233 and peptidase activity and molecular function this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0008360 and regulation of cell shape and biological process this GO :0009611 and response to wounding and biological process this GO :0010468 and regulation of gene expression and biological process this GO :0010544 and negative regulation of platelet activation and biological process this GO :0014068 and positive regulation of phosphatidylinositol 3-kinase signaling and biological process this GO :0017187 and peptidyl-glutamic acid carboxylation and biological process this GO :0030168 and platelet activation and biological process this GO :0030193 and regulation of blood coagulation and biological process this GO :0030194 and positive regulation of blood coagulation and biological process this GO :0030307 and positive regulation of cell growth and biological process this GO :0032967 and positive regulation of collagen biosynthetic process and biological process this GO :0042730 and fibrinolysis and biological process this GO :0043687 and post-translational protein modification and biological process this GO :0044267 and cellular protein metabolic process and biological process this GO :0045861 and negative regulation of proteolysis and biological process this GO :0048712 and negative regulation of astrocyte differentiation and biological process this GO :0050900 and leukocyte migration and biological process this GO :0051281 and positive regulation of release of sequestered calcium ion into cytosol and biological process this GO :0051480 and cytosolic calcium ion homeostasis and biological process this GO :0051918 and negative regulation of fibrinolysis and biological process this GO :0070053 and thrombospondin receptor activity and molecular function this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0072562 and blood microparticle and cellular component this GO :1900738 and positive regulation of phospholipase C-activating G-protein coupled receptor signaling pathway and biological process this GO :2000379 and positive regulation of reactive oxygen species metabolic process and biological process, this GO :0001934 and positive regulation of protein phosphorylation and biological process this GO :0003824 and catalytic activity and molecular function this GO :0004252 and serine-type endopeptidase activity and molecular function this GO :0005102 and receptor binding and molecular function this GO :0005509 and calcium ion binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005788 and endoplasmic reticulum lumen and cellular component this GO :0005796 and this GO lgi lumen and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006508 and proteolysis and biological process this GO :0006953 and acute-phase response and biological process this GO :0007166 and cell surface receptor signaling pathway and biological process this GO :0007275 and multicellular organismal development and biological process this GO :0007596 and blood coagulation and biological process this GO :0007597 and blood coagulation, this GO :0003824 : catalytic activity, this GO :0003824 : catalytic activity and also this GO :0004252 : serine-type endopeptidase activity and also this GO :0005102 : receptor binding and also this GO :0005509 : calcium ion binding and also this GO :0005515 : protein binding and also this GO :0008083 : growth factor activity and also this GO :0008233 : peptidase activity and also this GO :0070053 : thrombospondin receptor activity, this GO :0004252 : serine-type endopeptidase activity, this GO :0005102 : receptor binding, this GO :0005509 : calcium ion binding, this GO :0005515 : protein binding, this GO :0008083 : growth factor activity, this GO :0008233 : peptidase activity, this GO :0070053 : thrombospondin receptor activity, thrombospondin receptor activity, coagulation factor II (thrombin)

Related Products :

MBS621539 Antiplasmin, alpha2 (Alpha2-antiplasmin, SERPINF2, serpin peptidase inhibitor, clade F (alpha-2 antiplasmin, pigment epithelium derived factor), member 2, A2AP, AAP, ALPHA-2-PI, API, PLI, alpha-2-antiplasmin, alpha-2-plasmin inhibitor, serine (or cysteine Antibody 100ug 707 € MBS Polyclonals_1 human
CM08 Recombinant Mouse Serpin F2, Alpha-2-Antiplasmin (C-6His) 500 µg 1755 € novo mouse
CM07 Recombinant Mouse Serpin F2, Alpha-2-Antiplasmin (C-Fc) 500 µg 1613 € novo mouse
MBS622823 SERPINA10 (Serpin Peptidase Inhibitor Clade A (alpha-1 Antiproteinase Antitrypsin) Member 10, Serpin A10, Protein Z-dependent Protease Inhibitor, Protein Z-dependent Protease Inhibitor Precursor, PZ-dependent Protease Inhibitor, PZI, ZPI) 100ug 735 € MBS Polyclonals_1 human
C685 Recombinant Mouse Alpha-1-antitrypsin 1-1, Serpin A1a (C-6His) 1 mg 2486 € novo mouse
C695 Recombinant Mouse α-1-Antitrypsin 1-3, SERPIN A1b (C-6His) 10 µg 202 € novo human
C533 Recombinant Human Serpin A1, alpha-1-Antitrypsin (C-6His) 500 µg 1613 € novo human
C534 Recombinant Human Serpin A3, alpha-1-Antichymotrypsin (C-6His) 1 mg 2283 € novo human
MBS619680 SERPINB6 (Serpin Peptidase Inhibitor Clade B (Ovalbumin) Member 6, Serpin B6, Cytoplasmic Antiproteinase, CAP, MGC111370, MSTP057, Placental Thrombin Inhibitor, PTI, Protease Inhibitor 6, Protease Inhibitor 6 (Placental Thrombin Inhibitor), PI6, PI-6) Antibody 100ug 735 € MBS Polyclonals_1 human
MBS621879 SERPINB9 (Serpin Peptidase Inhibitor Clade B (Ovalbumin) Member 9, Serpin B9, Cytoplasmic Antiproteinase 3, CAP3, CAP-3, Protease Inhibitor 9, PI9, PI-9) 100ug 735 € MBS Polyclonals_1 human
CD21 Recombinant Mouse Plasminogen Activator Inhibitor 1, PAI-1, SERPIN E1 (C-6His) 1 mg 2486 € novo mouse
C665 Recombinant Mouse Serine Protease Inhibitor A3N, Serpin A3N (C-6His) 1 mg 2486 € novo mouse
CK98 Recombinant Mouse Serpin D1, Heparin Cofactor II, HCF2 (C-6His) 50 µg 496 € novo mouse
CJ07 Recombinant Mouse Serpin G1, C1 Inhibitor (C-6His) 500 µg 1613 € novo mouse
CB56 Recombinant Human Angiotensinogen, Serpin A8, AGT (C-6His) 50 µg 496 € novo human
CJ01 Recombinant Human Leukocyte Elastase Inhibitor, Serpin B1, SERPINB1 (C-6His) 1 mg 2283 € novo human
CA54 Recombinant Human Serpin A10, ZPI (C-6His) 500 µg 1613 € novo human
C928 Recombinant Human Serpin A4, Kallistatin (C-6His) 1 mg 2283 € novo human
C535 Recombinant Human Serpin A5, Protein C Inhibitor (C-6His) 500 µg 1613 € novo human
C639 Recombinant Human Serpin A6 , Transcortin (C-6His) 50 µg 496 € novo human
C536 Recombinant Human Serpin A7, TBG (C-6His) 50 µg 369 € novo human
CI96 Recombinant Human Serpin B12, SERPINB12 (C-6His) 500 µg 1613 € novo human
CJ63 Recombinant Human Serpin B3, SERPINB3, SCCA1 (C-6His) 1 mg 2486 € novo human
CM24 Recombinant Human Serpin B3, SERPINB3, SCCA1 (N-6His) 50 µg 496 € novo human
CE54 Recombinant Human Serpin B6, Placental Thrombin Inhibitor (N-Trx, 6His) 50 µg 496 € novo human
CJ32 Recombinant Human Serpin B9, SERPINB9 (C-6His) 50 µg 303 € novo human
C537 Recombinant Human Serpin E1, PAI-1 (C-6His) 10 µg 202 € novo human
C538 Recombinant Human Serpin F1, PEDF(C-6His) 50 µg 369 € novo human
C539 Recombinant Human Serpin G1, C1 Inhibitor (C-6His) 50 µg 369 € novo human
C800 Recombinant Human Serpin H1 (C-6His) 1 mg 2283 € novo human