Recombinant Mouse Activin Receptor-like Kinase 1, ALK-1, ACVRL1 (C-Fc)

Contact us
Catalog number: CK71
Price: 735 €
Supplier: MBS Polyclonals_1
Product name: Recombinant Mouse Activin Receptor-like Kinase 1, ALK-1, ACVRL1 (C-Fc)
Quantity: 100ug
Other quantities: 10 µg 80€ 50 µg 141€ 500 µg 659€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: Recombinant Mouse Activin Receptor-like Kinase 1 is produced by our Mammalian expression system and the target gene encoding Asp23-Pro119 is expressed with a Fc tag at the C-terminus
Molecular Weight: 1 kD, 38
UniProt number: Q61288
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: pH 7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: DLAKPSKLVNCTCESPHCKRPFCQGSWCTVVLVREQGRHPQVYRGCGSLNQELCLGRPTEFLNHHCCYRSFCNHNVSLMLEATQTPSEEPEVDAHLPVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: ACVRL1 (C-Fc), ALK-1, Activin Receptor-like Kinase 1
Short name: ACVRL1 (C-Fc), ALK-1, Recombinant Mouse Activin Receptor-like Kinase 1
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses, Mouse
Alternative name: activin A receptor classification II-like 1 (C-fragment c), anaplastic lymphoma receptor tyrosine kinase-1, recombinant Mouse Activin Receptor-like phosphorylation catalyst 1
Alternative technique: rec
Alternative to gene target: ACVRL1 and IDBG-33826 and ENSG00000139567 and 102723650, ACVRLK1 and ALK-1 and ALK1 and HHT and HHT2 and ORW2 and SKR3 and TSR-I, ALK and IDBG-42084 and ENSG00000171094 and 238, ALK and IDBG-636042 and ENSBTAG00000007379 and 536642, Acvrl1 and IDBG-185502 and ENSMUSG00000000530 and 11482, Alk and IDBG-197259 and ENSMUSG00000055471 and 11682, BT, CD246 and NBLST3, Cell surfaces, DNA-templated and biological process this GO :0006468 and protein phosphorylation and biological process this GO :0007162 and negative regulation of cell adhesion and biological process this GO :0007165 and signal transduction and biological process this GO :0007178 and transmembrane receptor protein serine/threonine kinase signaling pathway and biological process this GO :0007179 and transforming growth factor beta receptor signaling pathway and biological process this GO :0008015 and blood circulation and biological process this GO :0008217 and regulation of blood pressure and biological process this GO :0008285 and negative regulation of cell proliferation and biological process this GO :0009986 and cell surface and cellular component this GO :0010596 and negative regulation of endothelial cell migration and biological process this GO :0010862 and positive regulation of pathway-restricted SMAD protein phosphorylation and biological process this GO :0016020 and membrane and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0016361 and activin receptor activity, DNA-templated and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0046332 and SMAD binding and molecular function this GO :0046872 and metal ion binding and molecular function this GO :0048185 and activin binding and molecular function this GO :0048514 and blood vessel morphogenesis and biological process this GO :0050431 and transforming growth factor beta binding and molecular function this GO :0051291 and protein heterooli this GO merization and biological process this GO :0051895 and negative regulation of focal adhesion assembly and biological process this GO :0060836 and lymphatic endothelial cell differentiation and biological process this GO :0060840 and artery development and biological process this GO :0060841 and venous blood vessel development and biological process this GO :0061154 and endothelial tube morphogenesis and biological process this GO :0061298 and retina vasculature development in camera-type eye and biological process this GO :0071560 and cellular response to transforming growth factor beta stimulus and biological process this GO :0071773 and cellular response to BMP stimulus and biological process this GO :2000279 and negative regulation of DNA biosynthetic process and biological process, Plasma membranes, anaplastic lymphoma receptor tyrosine kinase, spreading of epidermal cells and biological process this GO :0043025 and neuronal cell body and cellular component this GO :0043535 and regulation of blood vessel endothelial cell migration and biological process this GO :0043537 and negative regulation of blood vessel endothelial cell migration and biological process this GO :0045602 and negative regulation of endothelial cell differentiation and biological process this GO :0045603 and positive regulation of endothelial cell differentiation and biological process this GO :0045766 and positive regulation of angiogenesis and biological process this GO :0045893 and positive regulation of transcription, this GO :0000187 and activation of MAPK activity and biological process this GO :0004672 and protein kinase activity and molecular function this GO :0004704 and NF-kappaB-inducing kinase activity and molecular function this GO :0004713 and protein tyrosine kinase activity and molecular function this GO :0004714 and transmembrane receptor protein tyrosine kinase activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005524 and ATP binding and molecular function this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006468 and protein phosphorylation and biological process this GO :0007165 and signal transduction and biological process this GO :0007169 and transmembrane receptor protein tyrosine kinase signaling pathway and biological process this GO :0007399 and nervous system development and biological process this GO :0008283 and cell proliferation and biological process this GO :0016020 and membrane and cellular component this GO :0016310 and phosphorylation and biological process this GO :0016772 and transferase activity, this GO :0001525 and angiogenesis and biological process this GO :0001701 and in utero embryonic development and biological process this GO :0001936 and regulation of endothelial cell proliferation and biological process this GO :0001937 and negative regulation of endothelial cell proliferation and biological process this GO :0001938 and positive regulation of endothelial cell proliferation and biological process this GO :0001946 and lymphangiogenesis and biological process this GO :0001955 and blood vessel maturation and biological process this GO :0001974 and blood vessel remodeling and biological process this GO :0002043 and blood vessel endothelial cell proliferation involved in sprouting angiogenesis and biological process this GO :0004672 and protein kinase activity and molecular function this GO :0004674 and protein serine/threonine kinase activity and molecular function this GO :0004675 and transmembrane receptor protein serine/threonine kinase activity and molecular function this GO :0004702 and receptor signaling protein serine/threonine kinase activity and molecular function this GO :0004713 and protein tyrosine kinase activity and molecular function this GO :0005024 and transforming growth factor beta-activated receptor activity and molecular function this GO :0005025 and transforming growth factor beta receptor activity, this GO :0004672 : protein kinase activity, this GO :0004672 : protein kinase activity, this GO :0004672 : protein kinase activity and also this GO :0004674 : protein serine/threonine kinase activity and also this GO :0004675 : transmembrane receptor protein serine/threonine kinase activity and also this GO :0004702 : receptor signaling protein serine/threonine kinase activity and also this GO :0004713 : protein tyrosine kinase activity and also this GO :0005024 : transforming growth factor beta-activated receptor activity and also this GO :0005025 : transforming growth factor beta receptor activity, this GO :0004672 : protein kinase activity and also this GO :0004704 : NF-kappaB-inducing kinase activity and also this GO :0004713 : protein tyrosine kinase activity and also this GO :0004714 : transmembrane receptor protein tyrosine kinase activity and also this GO :0005515 : protein binding and also this GO :0005524 : ATP binding and also this GO :0016772 : transferase activity, this GO :0004674 : protein serine/threonine kinase activity, this GO :0004675 : transmembrane receptor protein serine/threonine kinase activity, this GO :0004702 : receptor signaling protein serine/threonine kinase activity, this GO :0004704 : NF-kappaB-inducing kinase activity, this GO :0004713 : protein tyrosine kinase activity, this GO :0004713 : protein tyrosine kinase activity, this GO :0004714 : transmembrane receptor protein tyrosine kinase activity, this GO :0005024 : transforming growth factor beta-activated receptor activity, this GO :0005025 : transforming growth factor beta receptor activity, this GO :0005515 : protein binding, this GO :0005515 : protein binding, this GO :0005524 : ATP binding, this GO :0005524 : ATP binding, this GO :0016361 : activin receptor activity, this GO :0016772 : transferase activity, this GO :0016772 : transferase activity, this GO :0019901 : protein kinase binding, this GO :0046332 : SMAD binding, this GO :0046872 : metal ion binding, this GO :0048185 : activin binding, this GO :0050431 : transforming growth factor beta binding, transferase activity, transferring phosphorus-containing groups, transferring phosphorus-containing groups, transferring phosphorus-containing groups, transferring phosphorus-containing groups and also this GO :0019901 : protein kinase binding and also this GO :0046332 : SMAD binding and also this GO :0046872 : metal ion binding and also this GO :0048185 : activin binding and also this GO :0050431 : transforming growth factor beta binding, transferring phosphorus-containing groups and molecular function this GO :0018108 and peptidyl-tyrosine phosphorylation and biological process this GO :0038061 and NIK/NF-kappaB signaling and biological process this GO :0042981 and regulation of apoptotic process and biological process this GO :0043234 and protein complex and cellular component this GO :0046777 and protein autophosphorylation and biological process this GO :0048666 and neuron development and biological process this GO :0051092 and positive regulation of NF-kappaB transcription factor activity and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, transferring phosphorus-containing groups and molecular function this GO :0019901 and protein kinase binding and molecular function this GO :0023014 and signal transduction by phosphorylation and biological process this GO :0030308 and negative regulation of cell growth and biological process this GO :0030336 and negative regulation of cell migration and biological process this GO :0030425 and dendrite and cellular component this GO :0030509 and BMP signaling pathway and biological process this GO :0030513 and positive regulation of BMP signaling pathway and biological process this GO :0032332 and positive regulation of chondrocyte differentiation and biological process this GO :0032924 and activin receptor signaling pathway and biological process this GO :0035313 and wound healing, transforming growth factor beta receptor activity, type I, type I, type I and also this GO :0005515 : protein binding and also this GO :0005524 : ATP binding and also this GO :0016361 : activin receptor activity, type I and also this GO :0016772 : transferase activity, type I and molecular function this GO :0005515 and protein binding and molecular function this GO :0005524 and ATP binding and molecular function this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006275 and regulation of DNA replication and biological process this GO :0006355 and regulation of transcription, type I and molecular function this GO :0016772 and transferase activity, 28710 and IDBG-632173 and ENSBTAG00000013843 and 534536, 94, activin A receptor type II-like 1
Identity: 175
Gene: ACVRL1 | More about : ACVRL1
Long gene name: activin A receptor like type 1
Synonyms gene: ACVRLK1 ORW2
Synonyms gene name: activin A receptor type II-like 1 activin A receptor type IL
Synonyms: HHT2 ALK1 HHT
Locus: 12q13, 13
Discovery year: 1994-12-12
GenBank acession: L17075
Entrez gene record: 94
Pubmed identfication: 8397373 8640225 22718755
RefSeq identity: NM_000020
Classification: Type 1 receptor serine/threonine kinases
Havana BLAST/BLAT: OTTHUMG00000169507
Locus Specific Databases: Hereditary Hemorrhagic Telangiectasia (HHT) Mutation Database LRG_543

Related Products :

MBS623902 ACVR1, NT (Activin Receptor Type 1, Activin Receptor Type I, ACTR-I, Serine/Threonine-protein Kinase Receptor R1, SKR1, Activin Receptor-like Kinase 2, ALK-2, TGF-B Superfamily Receptor Type I, TSR-I, ACVRLK2) Antibody 200ul 603 € MBS Polyclonals_1 human
CK71 Recombinant Mouse Activin Receptor-like Kinase 1, ALK-1, ACVRL1 (C-Fc) 50 µg 141 € novo mouse
CM15 Recombinant Mouse Activin Receptor IB, Activin RIB, ALK-4, ACVR1B (C-Fc) 1 mg 1877 € novo mouse
CA76 Recombinant Human Activin Receptor 1A, Activin RI, ALK-2, ACVR1 (C-6His) 10 µg 100 € novo human
CA60 Recombinant Human Activin Receptor 1B, Activin RIB, ALK-4, ACVR1B (C-6His) 500 µg 709 € novo human
RP-1019M Recombinant Mouse ALK-1 / ACVRL1 Protein (His & Fc Tag) 100μg 624 € adv mouse
RP-1008RC Recombinant Cynomolgus ALK-1 / ACVRL1 Protein (Fc Tag) 100μg 624 € adv human
RP-0056H Recombinant Human ALK-1 / ACVRL1 Protein (Fc Tag) 100μg 624 € adv human
RP-0055H Recombinant Human ALK-1 / ACVRL1 Protein (His Tag) 100μg 624 € adv human
RP-2005R Recombinant Rat ALK-1 / ACVRL1 Protein (His & Fc Tag) 100μg 624 € adv rat
C561 Recombinant Human Activin Receptor 2A, Activin RIIA, ACVR2A (C-6His) 500 µg 1613 € novo human
CB60 Recombinant Human Activin Receptor 2A, Activin RIIA, ACVR2A (C-Fc-6His) 10 µg 100 € novo human
C302 Recombinant Human Activin Receptor 2B, Activin RIIB, ACVR2B (C-6His) 500 µg 1186 € novo human
CD58 Recombinant Human Activin Receptor 2B, Activin RIIB, ACVR2B (C-Fc-6His) 10 µg 100 € novo human
MBS615516 APJ Receptor (APLNR, Apelin receptor, AGTRL1, angiotensin II receptor-like 1, Angiotensin receptor-like 1, Apelin receptor, APJ, APJR, FLJ90771, G-protein coupled receptor APJ, HG11, MGC45246) Antibody 0.05 ml 536 € MBS Polyclonals_1 human
MBS619539 Orexin 1 Receptor (Orexin Receptor 1, Orexin Receptor-1, Orexin Receptor Type 1, OX1R, Hypocretin 1 Receptor, Hypocretin Receptor 1, Hypocretin Receptor-1, Hypocretin Receptor Type 1, HCRTR1) 100ug 735 € MBS Polyclonals_1 human
RP-3000C Recombinant Canine ALK1 / ACVRL1 Protein (Fc Tag) 100μg 624 € adv human
EKU02117 Activin Receptor Like Kinase 1 (ALK1) ELISA kit 1 plate of 96 wells 783 € Biomatik ELISA kits human
GWB-9D08A2 Activin receptor Like Kinase 1 antibody 1 vial 532 € genways human
F50788-0.08ML Activin receptor-like kinase 1 Antibody (ALK1) 0.08 ml 199 € NJS poly human
F50787-0.08ML Activin receptor-like kinase 2 Antibody (ALK2) 0.08 ml 199 € NJS poly human
MBS421383 Goat anti-Activin receptor-like kinase 1 Antibody 100ug 370 € MBS Polyclonals_1 human
DL-ALK1-Hu Human Activin Receptor Like Kinase 1 ALK1 ELISA Kit 96T 869 € DL elisas human
MBS622582 Plk1 (Polo Like Kinase 1, Polo-like Kinase 1, PLK-1, Polo-like Kinase, PLK, Serine/threonine Protein Kinase 13, STPK13, Serine/threonine Protein Kinase PLK1) 100ug 785 € MBS Polyclonals_1 human
MBS621409 Plk1 (Polo Like Kinase 1, Polo-like Kinase 1, PLK-1, Polo-like Kinase, PLK, Serine/threonine Protein Kinase 13, STPK13, Serine/threonine Protein Kinase PLK1) Antibody 100ug 785 € MBS Polyclonals_1 human
MBS622298 Hematopoietic Progenitor Kinase 1 (HPK1, Mitogen-activated Protein Kinase Kinase Kinase Kinase 1, MAP4K1, MAPK/ERK Kinase Kinase Kinase 1, MEK Kinase Kinase 1, MEKKK 1) Antibody 100ug 735 € MBS Polyclonals_1 human
MBS624216 MAP4K1, phosphorylated (Ser171) (Mitogen-activated Protein Kinase Kinase Kinase Kinase 1, MAPK/ERK Kinase Kinase Kinase 1, MEK Kinase Kinase 1, MEKKK 1, Hematopoietic Progenitor Kinase, HPK1) Antibody 200ul 603 € MBS Polyclonals_1 human
MBS623300 EphA4 (Ephrin Receptor Eph A4, Ephrin Receptor EphA4, Ephrin Type A Receptor 4, EPH Receptor A4, Eph A4, EPH-like Kinase 8, EK8, HEK8, Receptor Protein Tyrosine Kinase HEK8, SEK, TYRO1 Protein Tyrosine Kinase, Tyrosine Protein Kinase Receptor SEK, Tyrosin Antibody 50ug 928 € MBS Polyclonals_1 human
CJ03 Recombinant Mouse BMP Receptor IA, ALK-3, CD292 (C-Fc-6His) 500 µg 709 € novo mouse
MBS618949 EPHB2 (Ephrin Type-B Receptor 2, Tyrosine-protein Kinase Receptor EPH-3, DRT, Receptor Protein-Tyrosine Kinase HEK5, ERK, EPH-like Kinase 5, EK5, Tyrosine-protein Kinase TYRO5, Renal Carcinoma Antigen NY-REN-47, DRT, EPHT3, EPTH3, ERK, HEK5, TYRO5) 100ug 735 € MBS Polyclonals_1 human