| Reacts with: |
Mouse |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Mouse Activin Receptor-like Kinase 1 is produced by our Mammalian expression system and the target gene encoding Asp23-Pro119 is expressed with a Fc tag at the C-terminus |
| Molecular Weight: |
1 kD, 38 |
| UniProt number: |
Q61288 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
pH 7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
DLAKPSKLVNCTCESPHCKRPFCQGSWCTVVLVREQGRHPQVYRGCGSLNQELCLGRPTEFLNHHCCYRSFCNHNVSLMLEATQTPSEEPEVDAHLPVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Test: |
A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or |
| Latin name: |
Mus musculus |
| Group: |
recombinants |
| Gene target: |
ACVRL1 (C-Fc), ALK-1, Activin Receptor-like Kinase 1 |
| Short name: |
ACVRL1 (C-Fc), ALK-1, Recombinant Mouse Activin Receptor-like Kinase 1 |
| Technique: |
E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Mouses, Mouse |
| Alternative name: |
activin A receptor classification II-like 1 (C-fragment c), anaplastic lymphoma receptor tyrosine kinase-1, recombinant Mouse Activin Receptor-like phosphorylation catalyst 1 |
| Alternative technique: |
rec |
| Alternative to gene target: |
ACVRL1 and IDBG-33826 and ENSG00000139567 and 102723650, ACVRLK1 and ALK-1 and ALK1 and HHT and HHT2 and ORW2 and SKR3 and TSR-I, ALK and IDBG-42084 and ENSG00000171094 and 238, ALK and IDBG-636042 and ENSBTAG00000007379 and 536642, Acvrl1 and IDBG-185502 and ENSMUSG00000000530 and 11482, Alk and IDBG-197259 and ENSMUSG00000055471 and 11682, BT, CD246 and NBLST3, Cell surfaces, DNA-templated and biological process this GO :0006468 and protein phosphorylation and biological process this GO :0007162 and negative regulation of cell adhesion and biological process this GO :0007165 and signal transduction and biological process this GO :0007178 and transmembrane receptor protein serine/threonine kinase signaling pathway and biological process this GO :0007179 and transforming growth factor beta receptor signaling pathway and biological process this GO :0008015 and blood circulation and biological process this GO :0008217 and regulation of blood pressure and biological process this GO :0008285 and negative regulation of cell proliferation and biological process this GO :0009986 and cell surface and cellular component this GO :0010596 and negative regulation of endothelial cell migration and biological process this GO :0010862 and positive regulation of pathway-restricted SMAD protein phosphorylation and biological process this GO :0016020 and membrane and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0016361 and activin receptor activity, DNA-templated and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0046332 and SMAD binding and molecular function this GO :0046872 and metal ion binding and molecular function this GO :0048185 and activin binding and molecular function this GO :0048514 and blood vessel morphogenesis and biological process this GO :0050431 and transforming growth factor beta binding and molecular function this GO :0051291 and protein heterooli this GO merization and biological process this GO :0051895 and negative regulation of focal adhesion assembly and biological process this GO :0060836 and lymphatic endothelial cell differentiation and biological process this GO :0060840 and artery development and biological process this GO :0060841 and venous blood vessel development and biological process this GO :0061154 and endothelial tube morphogenesis and biological process this GO :0061298 and retina vasculature development in camera-type eye and biological process this GO :0071560 and cellular response to transforming growth factor beta stimulus and biological process this GO :0071773 and cellular response to BMP stimulus and biological process this GO :2000279 and negative regulation of DNA biosynthetic process and biological process, Plasma membranes, anaplastic lymphoma receptor tyrosine kinase, spreading of epidermal cells and biological process this GO :0043025 and neuronal cell body and cellular component this GO :0043535 and regulation of blood vessel endothelial cell migration and biological process this GO :0043537 and negative regulation of blood vessel endothelial cell migration and biological process this GO :0045602 and negative regulation of endothelial cell differentiation and biological process this GO :0045603 and positive regulation of endothelial cell differentiation and biological process this GO :0045766 and positive regulation of angiogenesis and biological process this GO :0045893 and positive regulation of transcription, this GO :0000187 and activation of MAPK activity and biological process this GO :0004672 and protein kinase activity and molecular function this GO :0004704 and NF-kappaB-inducing kinase activity and molecular function this GO :0004713 and protein tyrosine kinase activity and molecular function this GO :0004714 and transmembrane receptor protein tyrosine kinase activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005524 and ATP binding and molecular function this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006468 and protein phosphorylation and biological process this GO :0007165 and signal transduction and biological process this GO :0007169 and transmembrane receptor protein tyrosine kinase signaling pathway and biological process this GO :0007399 and nervous system development and biological process this GO :0008283 and cell proliferation and biological process this GO :0016020 and membrane and cellular component this GO :0016310 and phosphorylation and biological process this GO :0016772 and transferase activity, this GO :0001525 and angiogenesis and biological process this GO :0001701 and in utero embryonic development and biological process this GO :0001936 and regulation of endothelial cell proliferation and biological process this GO :0001937 and negative regulation of endothelial cell proliferation and biological process this GO :0001938 and positive regulation of endothelial cell proliferation and biological process this GO :0001946 and lymphangiogenesis and biological process this GO :0001955 and blood vessel maturation and biological process this GO :0001974 and blood vessel remodeling and biological process this GO :0002043 and blood vessel endothelial cell proliferation involved in sprouting angiogenesis and biological process this GO :0004672 and protein kinase activity and molecular function this GO :0004674 and protein serine/threonine kinase activity and molecular function this GO :0004675 and transmembrane receptor protein serine/threonine kinase activity and molecular function this GO :0004702 and receptor signaling protein serine/threonine kinase activity and molecular function this GO :0004713 and protein tyrosine kinase activity and molecular function this GO :0005024 and transforming growth factor beta-activated receptor activity and molecular function this GO :0005025 and transforming growth factor beta receptor activity, this GO :0004672 : protein kinase activity, this GO :0004672 : protein kinase activity, this GO :0004672 : protein kinase activity and also this GO :0004674 : protein serine/threonine kinase activity and also this GO :0004675 : transmembrane receptor protein serine/threonine kinase activity and also this GO :0004702 : receptor signaling protein serine/threonine kinase activity and also this GO :0004713 : protein tyrosine kinase activity and also this GO :0005024 : transforming growth factor beta-activated receptor activity and also this GO :0005025 : transforming growth factor beta receptor activity, this GO :0004672 : protein kinase activity and also this GO :0004704 : NF-kappaB-inducing kinase activity and also this GO :0004713 : protein tyrosine kinase activity and also this GO :0004714 : transmembrane receptor protein tyrosine kinase activity and also this GO :0005515 : protein binding and also this GO :0005524 : ATP binding and also this GO :0016772 : transferase activity, this GO :0004674 : protein serine/threonine kinase activity, this GO :0004675 : transmembrane receptor protein serine/threonine kinase activity, this GO :0004702 : receptor signaling protein serine/threonine kinase activity, this GO :0004704 : NF-kappaB-inducing kinase activity, this GO :0004713 : protein tyrosine kinase activity, this GO :0004713 : protein tyrosine kinase activity, this GO :0004714 : transmembrane receptor protein tyrosine kinase activity, this GO :0005024 : transforming growth factor beta-activated receptor activity, this GO :0005025 : transforming growth factor beta receptor activity, this GO :0005515 : protein binding, this GO :0005515 : protein binding, this GO :0005524 : ATP binding, this GO :0005524 : ATP binding, this GO :0016361 : activin receptor activity, this GO :0016772 : transferase activity, this GO :0016772 : transferase activity, this GO :0019901 : protein kinase binding, this GO :0046332 : SMAD binding, this GO :0046872 : metal ion binding, this GO :0048185 : activin binding, this GO :0050431 : transforming growth factor beta binding, transferase activity, transferring phosphorus-containing groups, transferring phosphorus-containing groups, transferring phosphorus-containing groups, transferring phosphorus-containing groups and also this GO :0019901 : protein kinase binding and also this GO :0046332 : SMAD binding and also this GO :0046872 : metal ion binding and also this GO :0048185 : activin binding and also this GO :0050431 : transforming growth factor beta binding, transferring phosphorus-containing groups and molecular function this GO :0018108 and peptidyl-tyrosine phosphorylation and biological process this GO :0038061 and NIK/NF-kappaB signaling and biological process this GO :0042981 and regulation of apoptotic process and biological process this GO :0043234 and protein complex and cellular component this GO :0046777 and protein autophosphorylation and biological process this GO :0048666 and neuron development and biological process this GO :0051092 and positive regulation of NF-kappaB transcription factor activity and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, transferring phosphorus-containing groups and molecular function this GO :0019901 and protein kinase binding and molecular function this GO :0023014 and signal transduction by phosphorylation and biological process this GO :0030308 and negative regulation of cell growth and biological process this GO :0030336 and negative regulation of cell migration and biological process this GO :0030425 and dendrite and cellular component this GO :0030509 and BMP signaling pathway and biological process this GO :0030513 and positive regulation of BMP signaling pathway and biological process this GO :0032332 and positive regulation of chondrocyte differentiation and biological process this GO :0032924 and activin receptor signaling pathway and biological process this GO :0035313 and wound healing, transforming growth factor beta receptor activity, type I, type I, type I and also this GO :0005515 : protein binding and also this GO :0005524 : ATP binding and also this GO :0016361 : activin receptor activity, type I and also this GO :0016772 : transferase activity, type I and molecular function this GO :0005515 and protein binding and molecular function this GO :0005524 and ATP binding and molecular function this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006275 and regulation of DNA replication and biological process this GO :0006355 and regulation of transcription, type I and molecular function this GO :0016772 and transferase activity, 28710 and IDBG-632173 and ENSBTAG00000013843 and 534536, 94, activin A receptor type II-like 1 |
| Identity: |
175 |
| Gene: |
ACVRL1 |
More about : ACVRL1 |
| Long gene name: |
activin A receptor like type 1 |
| Synonyms gene: |
ACVRLK1 ORW2 |
| Synonyms gene name: |
activin A receptor type II-like 1 activin A receptor type IL |
| Synonyms: |
HHT2 ALK1 HHT |
| Locus: |
12q13, 13 |
| Discovery year: |
1994-12-12 |
| GenBank acession: |
L17075 |
| Entrez gene record: |
94 |
| Pubmed identfication: |
8397373 8640225 22718755 |
| RefSeq identity: |
NM_000020 |
| Classification: |
Type 1 receptor serine/threonine kinases |
| Havana BLAST/BLAT: |
OTTHUMG00000169507 |
| Locus Specific Databases: |
Hereditary Hemorrhagic Telangiectasia (HHT) Mutation Database LRG_543 |