| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Ganglioside GM2 activator is produced by our Mammalian expression system and the target gene encoding Ser32-Ile193 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
18, 6 kD |
| UniProt number: |
P17900 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, 2 um filtered solution of 20 mM TrisHCl, 5, Lyophilized from a 0, pH7 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
SSFSWDNCDEGKDPAVIRSLTLEPDPIVVPGNVTLSVVGSTSVPLSSPLKVDLVLEKEVAGLWIKIPCTDYIGSCTFEHFCDVLDMLIPTGEPCPEPLRTYGLPCHCPFKEGTYSLPKSEFVVPDLELPSWLTTGNYRIESVLSSSGKRLGCIKIAASLKGIVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
GM2A (C-6His), Ganglioside GM2 Activator |
| Short name: |
GM2A (C-6His), Recombinant Ganglioside GM2 Activator |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
GM2A (C-6His), sapiens Ganglioside GM2 Activator, recombinant H |
| Alternative technique: |
rec |
| Identity: |
4367 |
| Gene: |
GM2A |
More about : GM2A |
| Long gene name: |
GM2 ganglioside activator |
| Synonyms gene name: |
GM2 ganglioside activator protein |
| Synonyms: |
SAP-3 |
| Synonyms name: |
cerebroside sulfate activator protein sphingolipid activator protein 3 |
| Locus: |
5q33, 1 |
| Discovery year: |
1986-01-01 |
| Entrez gene record: |
2760 |
| Pubmed identfication: |
115863 1915857 |
| RefSeq identity: |
NM_000405 |
| Havana BLAST/BLAT: |
OTTHUMG00000130124 |
| Locus Specific Databases: |
GM2A Locus Database |