| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human MOB Kinase Activator 1A is produced by our E, coli expression system and the target gene encoding Ser2-Arg216 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
26 kD |
| UniProt number: |
Q9H8S9 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
0, pH 8, 0 , 15M sodium chloride, 2 um filtered solution of 20 mM Tris, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
SFLFSSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRQAVMLPEGEDLNEWIAVNTVDFFNQINMLYGTITEFCTEASCPVMSAGPRYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDSVMQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKLGSKDRLEHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
MOB1A (C-6His), MOB Kinase Activator 1A |
| Short name: |
MOB1A (C-6His), Recombinant MOB Kinase Activator 1A |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
MOB1A (C-6His), sapiens MOB phosphorylation catalyst Activator 1A, recombinant H |
| Alternative technique: |
rec |
| Identity: |
16015 |
| Gene: |
MOB1A |
More about : MOB1A |
| Long gene name: |
MOB kinase activator 1A |
| Synonyms gene: |
C2orf6 MOBK1B MOBKL1B |
| Synonyms gene name: |
Mps One Binder kinase activator-like 1B (yeast) MOB1 Mps One Binder homolog A (yeast) , chromosome 2 open reading frame 6 MOB1 |
| Synonyms: |
FLJ10788 MOB1 FLJ11595 Mob4B Mats1 |
| Locus: |
2p13, 1 |
| Discovery year: |
2001-06-29 |
| Entrez gene record: |
55233 |
| Pubmed identfication: |
11319234 20624913 |
| RefSeq identity: |
NM_018221 |
| Classification: |
MOB kinase activators |
| Havana BLAST/BLAT: |
OTTHUMG00000152833 |