Recombinant Human Urokinase-Type Plasminogen Activator, uPA, PLAU (C-6His)

Contact us
Catalog number: C393
Price: 402 €
Supplier: abebio
Product name: Recombinant Human Urokinase-Type Plasminogen Activator, uPA, PLAU (C-6His)
Quantity: 1x plate of 48 wells
Other quantities: 1 mg 2283€ 10 µg 202€ 50 µg 496€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Urokinase is produced by our Mammalian expression system and the target gene encoding Ser21-Leu431 is expressed with a 6His tag at the C-terminus
Molecular Weight: 41 kD, 47
UniProt number: P00749
State of the product: Liquid
Shipping conditions: Dry ice/ice packs
Formulation: 10% Glycerol, 150 mM sodium chloride, 2 mM CaCl, pH 7, 2 um filtered solution of 20 mM HEPES, 5, Supplied as a 0
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: SNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLKPLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKEENGLALVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: PLAU (C-6His), uPA, Urokinase Plasminogen Activator
Short name: PLAU (C-6His), uPA, Recombinant Urokinase- Plasminogen Activator
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: plasminogen activator, sapiens Urokinase-classification Plasminogen Activator, uPA, urokinase (C-6His), recombinant H
Alternative technique: rec
Alternative to gene target: ATF and BDPLT5 and QPD and u-PA and UPA and URK, Extracellular, PLAU and IDBG-630603 and ENSBTAG00000005947 and 281408, PLAU and IDBG-78889 and ENSG00000122861 and 5328, Plau and IDBG-136606 and ENSMUSG00000021822 and 18792, protein binding, this GO :0001666 and response to hypoxia and biological process this GO :0003824 and catalytic activity and molecular function this GO :0004252 and serine-type endopeptidase activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006508 and proteolysis and biological process this GO :0006935 and chemotaxis and biological process this GO :0007165 and signal transduction and biological process this GO :0007596 and blood coagulation and biological process this GO :0009986 and cell surface and cellular component this GO :0010469 and regulation of receptor activity and biological process this GO :0014909 and smooth muscle cell migration and biological process this GO :0014910 and regulation of smooth muscle cell migration and biological process this GO :0033628 and regulation of cell adhesion mediated by integrin and biological process this GO :0042127 and regulation of cell proliferation and biological process this GO :0042730 and fibrinolysis and biological process this GO :0061041 and regulation of wound healing and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :2000097 and regulation of smooth muscle cell-matrix adhesion and biological process, this GO :0003824 : catalytic activity, this GO :0003824 : catalytic activity and also this GO :0004252 : serine-type endopeptidase activity and also this GO :0005515 : protein binding, this GO :0004252 : serine-type endopeptidase activity, this GO :0005515 : protein binding, urokinase, plasminogen activator
Identity: 9052
Gene: PLAU | More about : PLAU
Long gene name: plasminogen activator, urokinase
Synonyms: URK UPA
Locus: 10q22, 2
Discovery year: 2001-06-22
GenBank acession: BC013575
Entrez gene record: 5328
Pubmed identfication: 2415429
RefSeq identity: NM_002658
Havana BLAST/BLAT: OTTHUMG00000018494
Locus Specific Databases: LRG_593

Related Products :

C393 Recombinant Human Urokinase-Type Plasminogen Activator, uPA, PLAU (C-6His) 500 µg 1613 € novo human
GENTAUR-58bb3e862b020 Human Urokinase-type plasminogen activator (PLAU) 100ug 2155 € MBS Recombinant Proteins human
GENTAUR-58bb3e8684cee Human Urokinase-type plasminogen activator (PLAU) 1000ug 2155 € MBS Recombinant Proteins human
GENTAUR-58bb3e86d0685 Human Urokinase-type plasminogen activator (PLAU) 100ug 2669 € MBS Recombinant Proteins human
GENTAUR-58bb3e87314fd Human Urokinase-type plasminogen activator (PLAU) 1000ug 2669 € MBS Recombinant Proteins human
GENTAUR-58bb65351e0e3 Chicken Urokinase-type plasminogen activator (PLAU) 100ug 2166 € MBS Recombinant Proteins chicken
GENTAUR-58bb6535be4e7 Chicken Urokinase-type plasminogen activator (PLAU) 1000ug 2166 € MBS Recombinant Proteins chicken
GENTAUR-58bb653617cc8 Chicken Urokinase-type plasminogen activator (PLAU) 100ug 2680 € MBS Recombinant Proteins chicken
GENTAUR-58bb6536493ea Chicken Urokinase-type plasminogen activator (PLAU) 1000ug 2680 € MBS Recombinant Proteins chicken
GENTAUR-58b9d92f8bcda Papio cynocephalus Urokinase-type plasminogen activator (PLAU) 100ug 2161 € MBS Recombinant Proteins human
GENTAUR-58b9d9300a637 Papio cynocephalus Urokinase-type plasminogen activator (PLAU) 1000ug 2161 € MBS Recombinant Proteins human
GENTAUR-58b9d9307bdaa Papio cynocephalus Urokinase-type plasminogen activator (PLAU) 100ug 2674 € MBS Recombinant Proteins human
GENTAUR-58b9d930ce37c Papio cynocephalus Urokinase-type plasminogen activator (PLAU) 1000ug 2674 € MBS Recombinant Proteins human
GENTAUR-58b8e9e755c52 Pig Urokinase-type plasminogen activator (PLAU) 100ug 2183 € MBS Recombinant Proteins pig
GENTAUR-58b8e9e7ad681 Pig Urokinase-type plasminogen activator (PLAU) 1000ug 2183 € MBS Recombinant Proteins pig
GENTAUR-58b8e9e824763 Pig Urokinase-type plasminogen activator (PLAU) 100ug 2696 € MBS Recombinant Proteins pig
GENTAUR-58b8e9e8795d6 Pig Urokinase-type plasminogen activator (PLAU) 1000ug 2696 € MBS Recombinant Proteins pig
GENTAUR-58b9e60ee01a2 Pig Urokinase-type plasminogen activator (PLAU) 100ug 2183 € MBS Recombinant Proteins pig
GENTAUR-58b9e60f5f678 Pig Urokinase-type plasminogen activator (PLAU) 1000ug 2183 € MBS Recombinant Proteins pig
GENTAUR-58b9e61127d4f Pig Urokinase-type plasminogen activator (PLAU) 100ug 2696 € MBS Recombinant Proteins pig
GENTAUR-58b9e6117bb71 Pig Urokinase-type plasminogen activator (PLAU) 1000ug 2696 € MBS Recombinant Proteins pig
BMDV10196 Urokinase-type Plasminogen Activator (uPA), ~35kD (active) & ~55kD (proform), NO effect on fibrin dissolution, Clone: 4-19, Mouse Monoclonal antibody-Human; WB 500ul 887 € accurate-monoclonals human
DL-uPA-Hu Human Plasminogen Activator, Urokinase uPA ELISA Kit 96T 788 € DL elisas human
GENTAUR-58bdd63e195ca Anti- Plasminogen Activator, Urokinase (uPA) Antibody 100ug 597 € MBS Polyclonals human
GENTAUR-58bdd66f8b6f6 Anti- Plasminogen Activator, Urokinase (uPA) Antibody 100ug 564 € MBS Polyclonals human
GENTAUR-58bddd1d70d0f Anti- Plasminogen Activator, Urokinase (uPA) Antibody 50ug 398 € MBS Polyclonals human
GENTAUR-58bddd1dd0252 Anti- Plasminogen Activator, Urokinase (uPA) Antibody 100ug 520 € MBS Polyclonals human
DL-uPA-b Bovine Plasminogen Activator, Urokinase uPA ELISA Kit 96T 962 € DL elisas bovine
DL-uPA-Ch Chicken Plasminogen Activator, Urokinase uPA ELISA Kit 96T 904 € DL elisas chicken
AE27146MO-48 ELISA test for Mouse Urokinase plasminogen activator (uPA) 1x plate of 48 wells 402 € abebio mouse