Recombinant Human Ganglioside GM2 Activator, GM2A (C-6His)

Contact us
Catalog number: CI86
Price: 322 €
Supplier: ABM lentivectors
Product name: Recombinant Human Ganglioside GM2 Activator, GM2A (C-6His)
Quantity: 1.0 µg DNA
Other quantities: 1 mg 2486€ 50 µg 496€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Ganglioside GM2 activator is produced by our Mammalian expression system and the target gene encoding Ser32-Ile193 is expressed with a 6His tag at the C-terminus
Molecular Weight: 18, 6 kD
UniProt number: P17900
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM TrisHCl, 5, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: SSFSWDNCDEGKDPAVIRSLTLEPDPIVVPGNVTLSVVGSTSVPLSSPLKVDLVLEKEVAGLWIKIPCTDYIGSCTFEHFCDVLDMLIPTGEPCPEPLRTYGLPCHCPFKEGTYSLPKSEFVVPDLELPSWLTTGNYRIESVLSSSGKRLGCIKIAASLKGIVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: GM2A (C-6His), Ganglioside GM2 Activator
Short name: GM2A (C-6His), Recombinant Ganglioside GM2 Activator
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: GM2A (C-6His), sapiens Ganglioside GM2 Activator, recombinant H
Alternative technique: rec
Identity: 4367
Gene: GM2A | More about : GM2A
Long gene name: GM2 ganglioside activator
Synonyms gene name: GM2 ganglioside activator protein
Synonyms: SAP-3
Synonyms name: cerebroside sulfate activator protein sphingolipid activator protein 3
Locus: 5q33, 1
Discovery year: 1986-01-01
Entrez gene record: 2760
Pubmed identfication: 115863 1915857
RefSeq identity: NM_000405
Havana BLAST/BLAT: OTTHUMG00000130124
Locus Specific Databases: GM2A Locus Database

Related Products :

CI86 Recombinant Human Ganglioside GM2 Activator, GM2A (C-6His) 50 µg 496 € novo human
abx570825 Anti-Human GM2 Ganglioside Activator (GM2A) ELISA Kit 96 tests 847 € abbex human
DL-GM2A-Hu Human GM2 Ganglioside Activator GM2A ELISA Kit 96T 974 € DL elisas human
EKU04548 GM2 Ganglioside Activator (GM2A) ELISA kit 1 plate of 96 wells 899 € Biomatik ELISA kits human
abx166868 Anti-GM2 Ganglioside Activator Protein (Recombinant) 50 μg 601 € abbex human
abx262655 Anti-GM2 Ganglioside Activator Protein (Recombinant) 10 µg 340 € abbex human
abx128002 Anti-GM2 Ganglioside Activator Antibody 10 μg 282 € abbex human
MBS612340 Asialo GM2 (Asialoganglioside GM2) Antibody 0.05 ml 630 € MBS Polyclonals_1 human
RP-0750H Recombinant Human GM2A Protein (His Tag) 10μg 624 € adv human
MBS613014 PA11S (Proteasome Activator 11S Subunit REG gamma, Proteasome Activator 11S REG gamma, 11S Regulator Complex gamma Subunit, Activator of Multicatalytic Protease Subunit 3, Ki, Ki Antigen, Ki Nuclear Autoantigen, Ki, Proteasome (Prosome, Macropain) Activat Antibody 100ug 735 € MBS Polyclonals_1 human
abx250916 Anti-Human Anti-Ganglioside M1 Antibody ELISA Kit inquire 50 € abbex human
BMDV10258 CDw60, 9-0-Acetyl-GD3 Ganglioside, 120kD, Clone: Jones, Mouse Monoclonal antibody-Human; frozen/NO paraffin, IH/flow 500ul 509 € accurate-monoclonals human
BYA6515-1 CDw60, 9-0-Acetyl-GD3 Ganglioside, Clone: Jones, Mouse Monoclonal antibody-Human, Rat, Rabbit 500ul 755 € accurate-monoclonals rat
GENTAUR-58bd6cbff03f4 Human Ganglioside-induced differentiation-associated protein 2 (GDAP2) 100ug 2376 € MBS Recombinant Proteins human
GENTAUR-58bd6cc045d3a Human Ganglioside-induced differentiation-associated protein 2 (GDAP2) 1000ug 2376 € MBS Recombinant Proteins human
GENTAUR-58bd6cc090b88 Human Ganglioside-induced differentiation-associated protein 2 (GDAP2) 100ug 2890 € MBS Recombinant Proteins human
GENTAUR-58bd6cc0ca169 Human Ganglioside-induced differentiation-associated protein 2 (GDAP2) 1000ug 2890 € MBS Recombinant Proteins human
C297 Recombinant Human MOB Kinase Activator 1A, MOB1A (C-6His) 500 µg 1613 € novo human
CF29 Recombinant Human Signal Transducer and Activator of Transcription 3, STAT3 (C-6His) 1 mg 2486 € novo human
CG38 Recombinant Human Signal Transducer and Activator of Transcription 5B, STAT5B (C-6His) 50 µg 496 € novo human
CG37 Recombinant Human Signal Transducer and Activator of Transcription 6, STAT6 (C-6His) 10 µg 202 € novo human
CD67 Recombinant Human Tissue-Type Plasminogen Activator, PLAT (C-6His) 10 µg 202 € novo human
C382 Recombinant Human Urokinase Plasminogen Activator Surface Receptor, uPAR (C-6His) 500 µg 1613 € novo human
C393 Recombinant Human Urokinase-Type Plasminogen Activator, uPA, PLAU (C-6His) 500 µg 1613 € novo human
MBS243728 Anti-Human GM2A 50ug 597 € MBS Polyclonals_1 human
MBS247816 Anti-Human GM2A 50ug 597 € MBS Polyclonals_1 human
MBS244618 Anti-Human GM2A Antibody 50ug 597 € MBS Polyclonals_1 human
MBS247467 Anti-Human GM2A Antibody 50ug 597 € MBS Polyclonals_1 human
abx151696 Anti-Human GM2A ELISA Kit 96 tests 992 € abbex human
LV170884 GM2A Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human