Recombinant Human Myelin Protein P0-like 1, MPZL1 (C-6His)

Contact us
Catalog number: CI85
Price: 2283 €
Supplier: novo
Product name: Recombinant Human Myelin Protein P0-like 1, MPZL1 (C-6His)
Quantity: 1 mg
Other quantities: 1 mg 1115€ 50 µg 156€ 500 µg 709€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Myelin Protein P0-like 1 is produced by our Mammalian expression system and the target gene encoding Ser36-Val162 is expressed with a 6His tag at the C-terminus
Molecular Weight: 15, 2 kD
UniProt number: O95297
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: SALEVYTPKEIFVANGTQGKLTCKFKSTSTTGGLTSVSWSFQPEGADTTVSFFHYSQGQVYLGNYPPFKDRISWAGDLDKKDASINIENMQFIHNGTYICDVKNPPDIVVQPGHIRLYVVEKENLPVVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: MPZL1 (C-6His), Myelin Protein P0-like 1
Short name: MPZL1 (C-6His), Recombinant Myelin Protein P0-like 1
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: MPZL1 (C-6His), sapiens Myelin Protein P0-like 1, recombinant H
Alternative technique: rec
Identity: 7226
Gene: MPZL1 | More about : MPZL1
Long gene name: myelin protein zero like 1
Synonyms: PZR FLJ21047
Locus: 1q24, 2
Discovery year: 1999-06-14
GenBank acession: AF087020
Entrez gene record: 9019
Pubmed identfication: 9792637
RefSeq identity: NM_024569
Classification: V-set domain containing
Havana BLAST/BLAT: OTTHUMG00000034571

Related Products :

CI85 Recombinant Human Myelin Protein P0-like 1, MPZL1 (C-6His) 500 µg 709 € novo human
MBS617497 Myelin Protein Zero (MPZ, CHM, CMT1, CMT1B, CMT2I, CMT2J, CMT4E, CMTDI3, DSS, HMSNIB, Myelin Glycoprotein P-Zero, Myelin P0 Protein Precursor, Myelin Peripheral Protein, Myelin Protein Peripheral, MPP, Myelin Protein Zero (Charcot-Marie-Tooth Neuropathy 1 Antibody 0.25 ml 669 € MBS Polyclonals_1 human
GWB-ATG353 MPZL1, 38-162aa, Human, His tag, E.coli bulk Ask price € genways bulk human
AR51049PU-N anti-MPZL1 (38-162, His-tag) Antibody 0,25 mg 1413 € acr human
AR51049PU-S anti-MPZL1 (38-162, His-tag) Antibody 50 Вµg 587 € acr human
abx903317 Anti-MPZL1 siRNA 30 nmol 717 € abbex human
abx924496 Anti-MPZL1 siRNA inquire 50 € abbex human
abx924497 Anti-MPZL1 siRNA inquire 50 € abbex human
GWB-MQ443B MPZL1 antibody 1 vial 521 € genways human
GWB-213E32 MPZL1 Over-expression Lysate reagent 1 x 1 vial 463 € genways human
C238 Recombinant Human Myelin P2 Protein, PMP2 (N-6His) 500 µg 1613 € novo human
C802 Recombinant Human Myelin Protein P0, MPZ (C-6His) 50 µg 496 € novo human
C897 Recombinant Human Myelin-Associated Glycoprotein, MAG, Siglec-4a (C-6His) 50 µg 369 € novo human
C565 Recombinant Human Myelin Oligodendrocyte Glycoprotein, MOG (C-6His) 50 µg 369 € novo human
MBS621839 TBP-like Protein (TBP Like Protein TLP, TLP, TATA Box Binding Protein-like Protein 1, TBP-like 1, TBP-like Protein 1, TBPL1, 21kDa TBP-like Protein, Second TBP of Unique DNA, STUD, TATA Box Binding Protein-related Factor 2, TBP-related Factor 2, TRF2, TLF Antibody 100ug 735 € MBS Polyclonals_1 human
abx262672 Anti-Myelin Protein Zero-Like 1 Protein (Recombinant) 1 mg 6662 € abbex human
C527 Recombinant Human Protein Disulfide-Isomerase-Like Protein of the Testis, PDILT (C-6His) 50 µg 369 € novo human
GENTAUR-58bb5d13f17f7 Human Myelin protein zero-like protein 2 (MPZL2) 100ug 1442 € MBS Recombinant Proteins human
GENTAUR-58bb5d1448088 Human Myelin protein zero-like protein 2 (MPZL2) 1000ug 1442 € MBS Recombinant Proteins human
GENTAUR-58bb5d147fb95 Human Myelin protein zero-like protein 2 (MPZL2) 100ug 1945 € MBS Recombinant Proteins human
GENTAUR-58bb5d1522d2d Human Myelin protein zero-like protein 2 (MPZL2) 1000ug 1945 € MBS Recombinant Proteins human
DL-PLPL-Hu Human Myelin Proteolipid Protein Like Protein PLPL ELISA Kit 96T 974 € DL elisas human
CH76 Recombinant Human 2'-5'-Oligoadenylate Synthase-Like Protein, OASLOASL (C-6His) 10 µg 202 € novo human
CC55 Recombinant Human ADAM-like Protein Decysin-1, ADAMDEC1 (C-6His) 10 µg 146 € novo human
CS81 Recombinant Human Amyloid-like Protein 1, APLP-1 (C-6His) 500 µg 1328 € novo human
CH21 Recombinant Human Angiopoietin-Like Protein 8, ANGPTL8, Betatrophin (C-6His) 1 mg 2486 € novo human
CF02 Recombinant Human BAX, Bcl-2-Like Protein 4, BCL2L4 (N, C-6His) 1 mg 2486 € novo human
C104 Recombinant Human Bcl-2-Like Protein 1, BCL2L1 (C-6His) 50 µg 369 € novo human
CR24 Recombinant Human Bcl-2-like Protein 11, BIML (N-6His) 10 µg 202 € novo human
CA67 Recombinant Human CD99 Antigen-Like Protein 2, CD99L2 (C-6His) 1 mg 2283 € novo human