| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Myelin Oligodendrocyte Glycoprotein is produced by our Mammalian expression system and the target gene encoding Gly30-Gly154 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
15, 31 kD |
| UniProt number: |
Q16653 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
GQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPGVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
MOG (C-6His), Myelin Oligodendrocyte Glycoprotein |
| Short name: |
MOG (C-6His), Recombinant Myelin Oligodendrocyte Glycoprotein |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
myelin oli this GO dendrocyte glycoprotein (C-6His), sapiens Myelin Oligodendrocyte Glycoprotein, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
BTN6 and BTNL11 and MOGIG2 and NRCLP7, MOG and IDBG-635109 and ENSBTAG00000017818 and 280863, MOG and IDBG-73515 and ENSG00000204655 and 4340, Mog and IDBG-182135 and ENSMUSG00000076439 and 17441, Plasma membranes, protein binding, this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0007155 and cell adhesion and biological process this GO :0007417 and central nervous system development and biological process this GO :0016021 and integral component of membrane and cellular component this GO :0034126 and positive regulation of MyD88-dependent toll-like receptor signaling pathway and biological process, this GO :0005515 : protein binding, this GO :0005515 : protein binding, myelin oli this GO dendrocyte glycoprotein |
| Identity: |
7197 |
| Gene: |
MOG |
More about : MOG |
| Long gene name: |
myelin oligodendrocyte glycoprotein |
| Synonyms: |
BTN6 BTNL11 |
| Locus: |
6p22, 1 |
| Discovery year: |
1994-03-30 |
| Entrez gene record: |
4340 |
| RefSeq identity: |
NM_002433 |
| Classification: |
V-set domain containing Butyrophilins |
| Havana BLAST/BLAT: |
OTTHUMG00000031099 |