| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human ADAM-like protein decysin-1 is produced by our Mammalian expression system and the target gene encoding Ile31-Glu470 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
4 kD, 50 |
| UniProt number: |
O15204 |
| State of the product: |
Liquid |
| Shipping conditions: |
Dry Ice/ice packs |
| Formulation: |
1 mM ZnCl2, 150 mM sodium chloride, 2 um filtered solution of 20 mM TrisHCl, 5, Supplied as a 0, pH7 |
| Storage recommendations: |
-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
IAIKQTPELTLHEIVCPKKLHILHKREIKNNQTEKHGKEERYEPEVQYQMILNGEEIILSLQKTKHLLGPDYTETLYSPRGEEITTKPENMEHCYYKGNILNEKNSVASISTCDGLRGYFTHHHQRYQIKPLKSTDEKEHAVFTSNQEEQDPANHTCGVKSTDGKQGPIRISRSLKSPEKEDFLRAQKYIDLYLVLDNAFYKNYNENLTLIRSFVFDVMNLLNVIYNTIDVQVALVGMEIWSDGDKIKVVPSASTTFDNFLRWHSSNLGKKIHDHAQLLSGISFNNRRVGLAASNSLCSPSSVAVIEAKKKNNVALVGVMSHELGHVLGMPDVPFNTKCPSGSCVMNQYLSSKFPKDFSTSCRAHFERYLLSQKPKCLLQAPIPTNIMTTPVCGNHLLEVGEDCDCGSPKECTNLCCEALTCKLKPGTDCGGDAPNHTTEVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
ADAMDEC1 (C-6His), ADAM-like Protein Decysin-1 |
| Short name: |
ADAMDEC1 (C-6His), Recombinant ADAM-like Protein Decysin-1 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
ADAM-like, decysin 1 (C-6His), sapiens ADAM-like Protein Decysin-1, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
ADAMDEC1 and IDBG-12360 and ENSG00000134028 and 27299, ADAMDEC1 and IDBG-635222 and ENSBTAG00000001125 and 505890, Adamdec1 and IDBG-176764 and ENSMUSG00000022057 and 58860, Extracellular, decysin 1, this GO :0004222 and metalloendopeptidase activity and molecular function this GO :0005575 and cellular component and cellular component this GO :0005576 and extracellular region and cellular component this GO :0006508 and proteolysis and biological process this GO :0006955 and immune response and biological process this GO :0007162 and negative regulation of cell adhesion and biological process this GO :0008270 and zinc ion binding and molecular function, this GO :0004222 : metalloendopeptidase activity, this GO :0004222 : metalloendopeptidase activity and also this GO :0008270 : zinc ion binding, this GO :0008270 : zinc ion binding, zinc ion binding, 507019, ADAM-like |
| Identity: |
16299 |
| Gene: |
ADAMDEC1 |
More about : ADAMDEC1 |
| Long gene name: |
ADAM like decysin 1 |
| Synonyms: |
M12, 219 |
| Locus: |
8p21, 2 |
| Discovery year: |
2001-08-24 |
| GenBank acession: |
Y13323 |
| Entrez gene record: |
27299 |
| Pubmed identfication: |
9271581 12037602 |
| RefSeq identity: |
NM_014479 |
| Havana BLAST/BLAT: |
OTTHUMG00000097858 |