| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
6His tag at the C-terminus, Recombinant Human BCL2-associated X protein is produced by our E, coli expression system and the target gene encoding Met1-Gln171 is expressed with a 6His tag at the N-terminus |
| Molecular Weight: |
1 kD, 22 |
| UniProt number: |
Q07812 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MGSSHHHHHHSSGLVPRGSHMDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQLEHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
BCL2L4 (N, Bcl-2-Like Protein 4, C-6His), BAX |
| Short name: |
BCL2L4 (N, Bcl-2-Like Protein 4, C-6His), Recombinant BAX |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
BCL2L4 (N, Bcl-2-Like Protein 4, C-6His), sapiens BCL2-associated X protein, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
BAX and IDBG-61459 and ENSG00000087088 and 581, BAX and IDBG-640344 and ENSBTAG00000013340 and 100850136, BCL2L4, BH3 domain binding, Bax and IDBG-183241 and ENSMUSG00000003873 and 12028, nuclei, this GO :0001541 and ovarian follicle development and biological process this GO :0001764 and neuron migration and biological process this GO :0001776 and leukocyte homeostasis and biological process this GO :0001777 and T cell homeostatic proliferation and biological process this GO :0001782 and B cell homeostasis and biological process this GO :0001783 and B cell apoptotic process and biological process this GO :0001822 and kidney development and biological process this GO :0001836 and release of cytochrome c from mitochondria and biological process this GO :0001844 and protein insertion into mitochondrial membrane involved in apoptotic signaling pathway and biological process this GO :0001974 and blood vessel remodeling and biological process this GO :0002262 and myeloid cell homeostasis and biological process this GO :0002352 and B cell negative selection and biological process this GO :0002358 and B cell homeostatic proliferation and biological process this GO :0002904 and positive regulation of B cell apoptotic process and biological process this GO :0005515 and protein binding and molecular function this GO :0005622 and intracellular and cellular component this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005739 and mitochondrion and cellular component this GO :0005741 and mitochondrial outer membrane and cellular component this GO :0005757 and mitochondrial permeability transition pore complex and cellular component this GO :0005783 and endoplasmic reticulum and cellular component this GO :0005789 and endoplasmic reticulum membrane and cellular component this GO :0005829 and cytosol and cellular component this GO :0006687 and glycosphin this GO lipid metabolic process and biological process this GO :0006808 and regulation of nitrogen utilization and biological process this GO :0006915 and apoptotic process and biological process this GO :0006919 and activation of cysteine-type endopeptidase activity involved in apoptotic process and biological process this GO :0006927 and transformed cell apoptotic process and biological process this GO :0006974 and cellular response to DNA damage stimulus and biological process this GO :0007281 and germ cell development and biological process this GO :0007283 and spermatogenesis and biological process this GO :0007399 and nervous system development and biological process this GO :0007548 and sex differentiation and biological process this GO :0008053 and mitochondrial fusion and biological process this GO :0008283 and cell proliferation and biological process this GO :0008285 and negative regulation of cell proliferation and biological process this GO :0008289 and lipid binding and molecular function this GO :0008584 and male this GO nad development and biological process this GO :0008625 and extrinsic apoptotic signaling pathway via death domain receptors and biological process this GO :0008630 and intrinsic apoptotic signaling pathway in response to DNA damage and biological process this GO :0008635 and activation of cysteine-type endopeptidase activity involved in apoptotic process by cytochrome c and biological process this GO :0008637 and apoptotic mitochondrial changes and biological process this GO :0009566 and fertilization and biological process this GO :0009611 and response to wounding and biological process this GO :0009636 and response to toxic substance and biological process this GO :0009651 and response to salt stress and biological process this GO :0009791 and post-embryonic development and biological process this GO :0010212 and response to ionizing radiation and biological process this GO :0010248 and establishment or maintenance of transmembrane electrochemical gradient and biological process this GO :0010332 and response to gamma radiation and biological process this GO :0010524 and positive regulation of calcium ion transport into cytosol and biological process this GO :0015267 and channel activity and molecular function this GO :0016020 and membrane and cellular component this GO :0016032 and viral process and biological process this GO :0021854 and hypothalamus development and biological process this GO :0021987 and cerebral cortex development and biological process this GO :0031966 and mitochondrial membrane and cellular component this GO :0032091 and negative regulation of protein binding and biological process this GO :0032461 and positive regulation of protein oli this GO merization and biological process this GO :0032469 and endoplasmic reticulum calcium ion homeostasis and biological process this GO :0032471 and negative regulation of endoplasmic reticulum calcium ion concentration and biological process this GO :0032976 and release of matrix enzymes from mitochondria and biological process this GO :0033137 and negative regulation of peptidyl-serine phosphorylation and biological process this GO :0033599 and regulation of mammary gland epithelial cell proliferation and biological process this GO :0034644 and cellular response to UV and biological process this GO :0035108 and limb morphogenesis and biological process this GO :0035234 and ectopic germ cell programmed cell death and biological process this GO :0042475 and odontogenesis of dentin-containing tooth and biological process this GO :0042802 and identical protein binding and molecular function this GO :0042803 and protein homodimerization activity and molecular function this GO :0042981 and regulation of apoptotic process and biological process this GO :0043065 and positive regulation of apoptotic process and biological process this GO :0043281 and regulation of cysteine-type endopeptidase activity involved in apoptotic process and biological process this GO :0043496 and regulation of protein homodimerization activity and biological process this GO :0043497 and regulation of protein heterodimerization activity and biological process this GO :0043523 and regulation of neuron apoptotic process and biological process this GO :0043524 and negative regulation of neuron apoptotic process and biological process this GO :0043525 and positive regulation of neuron apoptotic process and biological process this GO :0043653 and mitochondrial fragmentation involved in apoptotic process and biological process this GO :0045136 and development of secondary sexual characteristics and biological process this GO :0046666 and retinal cell programmed cell death and biological process this GO :0046930 and pore complex and cellular component this GO :0046982 and protein heterodimerization activity and molecular function this GO :0048087 and positive regulation of developmental pigmentation and biological process this GO :0048147 and negative regulation of fibroblast proliferation and biological process this GO :0048515 and spermatid differentiation and biological process this GO :0048597 and post-embryonic camera-type eye morphogenesis and biological process this GO :0048678 and response to axon injury and biological process this GO :0048872 and homeostasis of number of cells and biological process this GO :0048873 and homeostasis of number of cells within a tissue and biological process this GO :0051259 and protein oli this GO merization and biological process this GO :0051260 and protein homooli this GO merization and biological process this GO :0051281 and positive regulation of release of sequestered calcium ion into cytosol and biological process this GO :0051402 and neuron apoptotic process and biological process this GO :0051434 and BH3 domain binding and molecular function this GO :0051726 and regulation of cell cycle and biological process this GO :0051881 and regulation of mitochondrial membrane potential and biological process this GO :0060011 and Sertoli cell proliferation and biological process this GO :0060041 and retina development in camera-type eye and biological process this GO :0060058 and positive regulation of apoptotic process involved in mammary gland involution and biological process this GO :0060068 and vagina development and biological process this GO :0070059 and intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0070242 and thymocyte apoptotic process and biological process this GO :0070584 and mitochondrion morphogenesis and biological process this GO :0071310 and cellular response to organic substance and biological process this GO :0072332 and intrinsic apoptotic signaling pathway by p53 class mediator and biological process this GO :0090200 and positive regulation of release of cytochrome c from mitochondria and biological process this GO :0097136 and Bcl-2 family protein complex and cellular component this GO :0097144 and BAX complex and cellular component this GO :0097190 and apoptotic signaling pathway and biological process this GO :0097191 and extrinsic apoptotic signaling pathway and biological process this GO :0097192 and extrinsic apoptotic signaling pathway in absence of ligand and biological process this GO :0097193 and intrinsic apoptotic signaling pathway and biological process this GO :0097296 and activation of cysteine-type endopeptidase activity involved in apoptotic signaling pathway and biological process this GO :1900103 and positive regulation of endoplasmic reticulum unfolded protein response and biological process this GO :1901030 and positive regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway and biological process this GO :1902108 and regulation of mitochondrial membrane permeability involved in apoptotic process and biological process this GO :1902110 and positive regulation of mitochondrial membrane permeability involved in apoptotic process and biological process this GO :1902262 and apoptotic process involved in patterning of blood vessels and biological process this GO :1902263 and apoptotic process involved in embryonic digit morphogenesis and biological process this GO :1902445 and regulation of mitochondrial membrane permeability involved in programmed necrotic cell death and biological process this GO :1902512 and positive regulation of apoptotic DNA fragmentation and biological process this GO :1990009 and retinal cell apoptotic process and biological process this GO :1990117 and B cell receptor apoptotic signaling pathway and biological process this GO :2001234 and negative regulation of apoptotic signaling pathway and biological process this GO :2001241 and positive regulation of extrinsic apoptotic signaling pathway in absence of ligand and biological process this GO :2001244 and positive regulation of intrinsic apoptotic signaling pathway and biological process, this GO :0005515 : protein binding, this GO :0005515 : protein binding and also this GO :0008289 : lipid binding and also this GO :0015267 : channel activity and also this GO :0042802 : identical protein binding and also this GO :0042803 : protein homodimerization activity and also this GO :0046982 : protein heterodimerization activity and also this GO :0051434 : BH3 domain binding, this GO :0008289 : lipid binding, this GO :0015267 : channel activity, this GO :0042802 : identical protein binding, this GO :0042803 : protein homodimerization activity, this GO :0046982 : protein heterodimerization activity, this GO :0051434 : BH3 domain binding, 280730, BCL2-associated X protein |
| Identity: |
959 |
| Gene: |
BAX |
More about : BAX |
| Long gene name: |
BCL2 associated X, apoptosis regulator |
| Synonyms gene name: |
BCL2-associated X protein BCL2 associated X protein |
| Synonyms: |
BCL2L4 |
| Locus: |
19q13, 33 |
| Discovery year: |
1994-11-08 |
| Entrez gene record: |
581 |
| Pubmed identfication: |
8358790 |
| RefSeq identity: |
NM_138763 |
| Classification: |
BCL2 family |
| Havana BLAST/BLAT: |
OTTHUMG00000160476 |