| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Bcl-2-like Protein 11 is produced by our E, coli expression system and the target gene encoding Met1-Arg120 is expressed with a 6His tag at the N-terminus |
| Molecular Weight: |
15 kD |
| UniProt number: |
O43521-2 |
| State of the product: |
Liquid |
| Shipping conditions: |
Dry Ice/ice packs |
| Formulation: |
10% glycerol, 150 mM sodium chloride, 2 mM DTT, pH8, 2 um filtered solution of 20 mM HEPES, Supplied as a 0 |
| Storage recommendations: |
-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MNHKVHHHHHHMAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPR |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
BIML (N-6His), Bcl-2-like Protein 11 |
| Short name: |
BIML (N-6His), Recombinant Bcl-2-like Protein 11 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
BIML (N-6His), sapiens Bcl-2-like Protein 11, recombinant H |
| Alternative technique: |
rec |
| Identity: |
994 |
| Gene: |
BCL2L11 |
More about : BCL2L11 |
| Long gene name: |
BCL2 like 11 |
| Synonyms gene name: |
BCL2-like 11 (apoptosis facilitator) |
| Synonyms: |
BOD BimL BimEL BimS BIM |
| Locus: |
2q13 |
| Discovery year: |
1999-12-10 |
| GenBank acession: |
AF032458 |
| Entrez gene record: |
10018 |
| Pubmed identfication: |
9731710 9430630 |
| Classification: |
BCL2 homology region 3 (BH3) only |
| Havana BLAST/BLAT: |
OTTHUMG00000131256 |
| Locus Specific Databases: |
LRG_620 |