| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Complement factor H is produced by our Mammalian expression system and the target gene encoding Glu19-Leu449 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
50 kD |
| UniProt number: |
P08603-2 |
| State of the product: |
Liquid |
| Shipping conditions: |
Dry ice/ice packs |
| Formulation: |
2 um filtered solution of phosphate buffered saline, 20%Glycerol, 4, 5% Trehalose, Supplied as a 0, pH7 |
| Storage recommendations: |
-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
EDCNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLGNVIMVCRKGEWVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKAVYTCNEGYQLLGEINYRECDTDGWTNDIPICEVVKCLPVTAPENGKIVSSAMEPDREYHFGQAVRFVCNSGYKIEGDEEMHCSDDGFWSKEKPKCVEISCKSPDVINGSPISQKIIYKENERFQYKCNMGYEYSERGDAVCTESGWRPLPSCEEKSCDNPYIPNGDYSPLRIKHRTGDEITYQCRNGFYPATRGNTAKCTSTGWIPAPRCTLKPCDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDHIHCTQDGWSPAVPCLRKCYFPYLENGYNQNYGRKFVQGKSIDVACHPGYALPKAQTTVTCMENGWSPTPRCIRVSFTLVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
CFH (C-6His), Complement Factor H |
| Short name: |
CFH (C-6His), Recombinant Complement Factor H |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
complement factor H (C-6His), sapiens Complement Factor H, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
AHUS1 and AMBP1 and ARMD4 and ARMS1 and CFHL3 and FH and FHL1 and HF and HF1 and HF2 and HUS, CFH and IDBG-105504 and ENSG00000000971 and 3075, Extracellular, alternative pathway and biological process this GO :0008201 and heparin binding and molecular function this GO :0030449 and regulation of complement activation and biological process this GO :0043395 and heparan sulfate proteoglycan binding and molecular function this GO :0045087 and innate immune response and biological process this GO :0072562 and blood microparticle and cellular component, heparan sulfate proteoglycan binding, this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0006956 and complement activation and biological process this GO :0006957 and complement activation, this GO :0005515 : protein binding, this GO :0005515 : protein binding and also this GO :0008201 : heparin binding and also this GO :0043395 : heparan sulfate proteoglycan binding, this GO :0008201 : heparin binding, this GO :0043395 : heparan sulfate proteoglycan binding, complement factor H |
| Identity: |
4883 |
| Gene: |
CFH |
More about : CFH |
| Long gene name: |
complement factor H |
| Synonyms gene: |
HF HF1 HF2 |
| Synonyms gene name: |
H factor 1 (complement) |
| Synonyms: |
HUS FHL1 ARMS1 ARMD4 |
| Synonyms name: |
beta-1H H factor 2 (complement) age-related maculopathy susceptibility 1 |
| Locus: |
1q31, 3 |
| Discovery year: |
1986-01-01 |
| GenBank acession: |
Y00716 |
| Entrez gene record: |
3075 |
| Pubmed identfication: |
2889480 2963625 |
| RefSeq identity: |
NM_000186 |
| Classification: |
Sushi domain containing Complement system |
| Havana BLAST/BLAT: |
OTTHUMG00000035607 |
| Locus Specific Databases: |
CFHbase: Mutation registry for Factor H deficiency (previously known as HF1base) LRG_47 |