Recombinant Human Complement Factor H, CFH (C-6His)

Contact us
Catalog number: CI77
Price: 520 €
Supplier: MBS Polyclonals
Product name: Recombinant Human Complement Factor H, CFH (C-6His)
Quantity: 100ug
Other quantities: 1 mg 2486€ 10 µg 202€ 50 µg 496€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Complement factor H is produced by our Mammalian expression system and the target gene encoding Glu19-Leu449 is expressed with a 6His tag at the C-terminus
Molecular Weight: 50 kD
UniProt number: P08603-2
State of the product: Liquid
Shipping conditions: Dry ice/ice packs
Formulation: 2 um filtered solution of phosphate buffered saline, 20%Glycerol, 4, 5% Trehalose, Supplied as a 0, pH7
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: EDCNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLGNVIMVCRKGEWVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKAVYTCNEGYQLLGEINYRECDTDGWTNDIPICEVVKCLPVTAPENGKIVSSAMEPDREYHFGQAVRFVCNSGYKIEGDEEMHCSDDGFWSKEKPKCVEISCKSPDVINGSPISQKIIYKENERFQYKCNMGYEYSERGDAVCTESGWRPLPSCEEKSCDNPYIPNGDYSPLRIKHRTGDEITYQCRNGFYPATRGNTAKCTSTGWIPAPRCTLKPCDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDHIHCTQDGWSPAVPCLRKCYFPYLENGYNQNYGRKFVQGKSIDVACHPGYALPKAQTTVTCMENGWSPTPRCIRVSFTLVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: CFH (C-6His), Complement Factor H
Short name: CFH (C-6His), Recombinant Complement Factor H
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: complement factor H (C-6His), sapiens Complement Factor H, recombinant H
Alternative technique: rec
Alternative to gene target: AHUS1 and AMBP1 and ARMD4 and ARMS1 and CFHL3 and FH and FHL1 and HF and HF1 and HF2 and HUS, CFH and IDBG-105504 and ENSG00000000971 and 3075, Extracellular, alternative pathway and biological process this GO :0008201 and heparin binding and molecular function this GO :0030449 and regulation of complement activation and biological process this GO :0043395 and heparan sulfate proteoglycan binding and molecular function this GO :0045087 and innate immune response and biological process this GO :0072562 and blood microparticle and cellular component, heparan sulfate proteoglycan binding, this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0006956 and complement activation and biological process this GO :0006957 and complement activation, this GO :0005515 : protein binding, this GO :0005515 : protein binding and also this GO :0008201 : heparin binding and also this GO :0043395 : heparan sulfate proteoglycan binding, this GO :0008201 : heparin binding, this GO :0043395 : heparan sulfate proteoglycan binding, complement factor H
Identity: 4883
Gene: CFH | More about : CFH
Long gene name: complement factor H
Synonyms gene: HF HF1 HF2
Synonyms gene name: H factor 1 (complement)
Synonyms: HUS FHL1 ARMS1 ARMD4
Synonyms name: beta-1H H factor 2 (complement) age-related maculopathy susceptibility 1
Locus: 1q31, 3
Discovery year: 1986-01-01
GenBank acession: Y00716
Entrez gene record: 3075
Pubmed identfication: 2889480 2963625
RefSeq identity: NM_000186
Classification: Sushi domain containing Complement system
Havana BLAST/BLAT: OTTHUMG00000035607
Locus Specific Databases: CFHbase: Mutation registry for Factor H deficiency (previously known as HF1base) LRG_47

Related Products :

CI77 Recombinant Human Complement Factor H, CFH (C-6His) 50 µg 496 € novo human
RP-0466H Recombinant Human Complement Factor H / CFH Protein (His Tag) 50μg 624 € adv human
abx575112 Anti-Human Complement Factor H (CFH) ELISA Kit inquire 50 € abbex human
GWB-9DA430 Complement Factor H (CFH) Goat antibody to or anti-Human Polyclonal (Internal) antibody 1 vial 602 € genways human
MBS243044 Goat Polyclonal (IgG) to Human CFH / Complement Factor H Antibody 50ug 597 € MBS Polyclonals_1 human
MBS242118 Goat Polyclonal to Human CFH / Complement Factor H Antibody 50ug 597 € MBS Polyclonals_1 human
DL-CFH-Hu Human Complement Factor H CFH ELISA Kit 96T 846 € DL elisas human
GENTAUR-58bde7d1b6786 Mouse Monoclonal [clone 63G5] (IgG2b,k) to Human CFH / Complement Factor H Antibody 0.05 ml 597 € MBS mono human
GENTAUR-58bde619845db Mouse Monoclonal [clone OX-24] (IgG1) to Human CFH / Complement Factor H Antibody 50ug 597 € MBS mono human
GENTAUR-58bde61edcae2 Mouse Monoclonal [clone OX-24] (IgG1) to Human CFH / Complement Factor H Antibody 50ug 597 € MBS mono human
MBS242293 Sheep Polyclonal to Human CFH / Complement Factor H Antibody 0.25 miligrams 597 € MBS Polyclonals_1 human
AP08882PU-N anti-Complement factor H (CFH) (577-588) Antibody 50 Вµg 732 € acr human
AM01334PU-N anti-Complement factor H (CFH) Antibody 0,1 mg 630 € acr human
AM20110PU-N anti-Complement factor H (CFH) Antibody 50 Вµg 732 € acr human
AM20168PU-N anti-Complement factor H (CFH) Antibody 50 Вµg 732 € acr human
AM32976FC-N anti-Complement factor H (CFH) Antibody 0,1 mg 616 € acr human
AM32976PU-N anti-Complement factor H (CFH) Antibody 0,1 mg 543 € acr human
AP22824PU-N anti-Complement factor H (CFH) Antibody 0,25 mg 732 € acr human
BP445 anti-Complement factor H (CFH) Antibody 1 ml 659 € acr human
GENTAUR-58bdcae78d6b1 Anti- Complement Factor H (CFH) Antibody 100ug 486 € MBS Polyclonals human
GENTAUR-58bdcb741522e Anti- Complement Factor H (CFH) Antibody 100ug 481 € MBS Polyclonals human
GENTAUR-58bdcb7484576 Anti- Complement Factor H (CFH) Antibody 50ug 370 € MBS Polyclonals human
GENTAUR-58bdcd306a133 Anti- Complement Factor H (CFH) Antibody 100ug 459 € MBS Polyclonals human
GENTAUR-58bdcd30b924d Anti- Complement Factor H (CFH) Antibody 50ug 359 € MBS Polyclonals human
GENTAUR-58bdd0caa515c Anti- Complement Factor H (CFH) Antibody 100ug 453 € MBS Polyclonals human
GENTAUR-58bdd0cb28548 Anti- Complement Factor H (CFH) Antibody 50ug 354 € MBS Polyclonals human
GENTAUR-58bdd1cd3f18d Anti- Complement Factor H (CFH) Antibody 100ug 498 € MBS Polyclonals human
GENTAUR-58bdd389740ea Anti- Complement Factor H (CFH) Antibody 100ug 520 € MBS Polyclonals human
GENTAUR-58bdd3ee6adb2 Anti- Complement Factor H (CFH) Antibody 100ug 531 € MBS Polyclonals human
GENTAUR-58bdda52d23dd Anti- Complement Factor H (CFH) Antibody 100ug 520 € MBS Polyclonals human