| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Interferon gamma receptor 1 is produced by our Mammalian expression system and the target gene encoding Glu18-Ser245 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
28, 7 kD |
| UniProt number: |
P15260 |
| State of the product: |
Liquid |
| Shipping conditions: |
Dry Ice/ice packs |
| Formulation: |
150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Supplied as a 0, pH7 |
| Storage recommendations: |
-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
EMGTADLGPSSVPTPTNVTIESYNMNPIVYWEYQIMPQVPVFTVEVKNYGVKNSEWIDACINISHHYCNISDHVGDPSNSLWVRVKARVGQKESAYAKSEEFAVCRDGKIGPPKLDIRKEEKQIMIDIFHPSVFVNGDEQEVDYDPETTCYIRVYNVYVRMNGSEIQYKILTQKEDDCDEIQCQLAIPVSSLNSQYCVSAEGVLHVWGVTTEKSKEVCITIFNSSIKGVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
IFNGR1 (C-6His), Receptor 1, Interferon &gamma |
| Short name: |
IFNGR1 (C-6His), Receptor 1, Recombinant Interferon &gamma |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans |
| Alternative name: |
Receptor 1, interferon g receptor 1 (C-6His), sapiens Interferon &gamma, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
BT, CD119 and IFNGR and IMD27A and IMD27B, IFNGR1 and IDBG-97020 and ENSG00000027697 and 3459, Ifngr1 and IDBG-135936 and ENSMUSG00000020009 and 15979, Plasma membranes, cytokine binding, this GO :0004906 and interferon-gamma receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005783 and endoplasmic reticulum and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0007165 and signal transduction and biological process this GO :0009615 and response to virus and biological process this GO :0014069 and postsynaptic density and cellular component this GO :0016020 and membrane and cellular component this GO :0019221 and cytokine-mediated signaling pathway and biological process this GO :0019955 and cytokine binding and molecular function this GO :0030425 and dendrite and cellular component this GO :0031982 and vesicle and cellular component this GO :0045087 and innate immune response and biological process this GO :0060333 and interferon-gamma-mediated signaling pathway and biological process this GO :0060334 and regulation of interferon-gamma-mediated signaling pathway and biological process, this GO :0004906 : interferon-gamma receptor activity, this GO :0004906 : interferon-gamma receptor activity and also this GO :0005515 : protein binding and also this GO :0019955 : cytokine binding, this GO :0005515 : protein binding, this GO :0019955 : cytokine binding, 49564 and IDBG-633678 and ENSBTAG00000012544 and 508619, interferon gamma receptor 1 |
| Identity: |
5439 |
| Gene: |
IFNGR1 |
More about : IFNGR1 |
| Long gene name: |
interferon gamma receptor 1 |
| Synonyms gene: |
IFNGR |
| Synonyms: |
CD119 |
| Locus: |
6q23, 3 |
| Discovery year: |
1986-01-01 |
| Entrez gene record: |
3459 |
| Classification: |
Interferon receptors CD molecules |
| Havana BLAST/BLAT: |
OTTHUMG00000015656 |
| Locus Specific Databases: |
IFNGR1base: Mutation registry for IFN&, #947, 1-receptor deficiency LRG_66 |