| Reacts with: |
Mouse |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Mouse Interferon gamma Receptor 1 is produced by our Mammalian expression system and the target gene encoding Ala26-Asp253 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
26, 9 kD |
| UniProt number: |
P15261 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, pH7, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
ALTSTEDPEPPSVPVPTNVLIKSYNLNPVVCWEYQNMSQTPIFTVQVKVYSGSWTDSCTNISDHCCNIYEQIMYPDVSAWARVKAKVGQKESDYARSKEFLMCLKGKVGPPGLEIRRKKEEQLSVLVFHPEVVVNGESQGTMFGDGSTCYTFDYTVYVEHNRSGEILHTKHTVEKEECNETLCELNISVSTLDSRYCISVDGISSFWQVRTEKSKDVCIPPFHDDRKDVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Test: |
A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or |
| Latin name: |
Mus musculus |
| Group: |
recombinants |
| Gene target: |
CD119 (C-6His), IFN-&gamma, R1, Receptor 1, Interferon &gamma |
| Short name: |
CD119 (C-6His), IFN-&gamma, R1, Receptor 1, Recombinant Mouse Interferon &gamma |
| Technique: |
E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Mouses |
| Alternative name: |
CD119 (C-6His), Interferon-&gamma, R1, Receptor 1, recombinant Mouse Interferon &gamma |
| Alternative technique: |
rec |
| Identity: |
5439 |
| Gene: |
IFNGR1 |
More about : IFNGR1 |
| Long gene name: |
interferon gamma receptor 1 |
| Synonyms gene: |
IFNGR |
| Synonyms: |
CD119 |
| Locus: |
6q23, 3 |
| Discovery year: |
1986-01-01 |
| Entrez gene record: |
3459 |
| Classification: |
Interferon receptors CD molecules |
| Havana BLAST/BLAT: |
OTTHUMG00000015656 |
| Locus Specific Databases: |
IFNGR1base: Mutation registry for IFN&, #947, 1-receptor deficiency LRG_66 |