Recombinant Human Interferon γ, IFN-γ

Contact us
Catalog number: CI57
Price: 402 €
Supplier: abebio
Product name: Recombinant Human Interferon γ, IFN-γ
Quantity: 1x plate of 48 wells
Other quantities: 1 mg 912€ 10 µg 100€ 500 µg 709€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Interferon gamma is produced by our Mammalian expression system and the target gene encoding Gln24-Gln166 is expressed
Molecular Weight: 16, 8 kD
UniProt number: P01579
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: IFN-&gamma, Interferon &gamma
Short name: IFN-&gamma, Recombinant Interferon &gamma
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans
Alternative name: Interferon-&gamma, sapiens Interferon &gamma, recombinant H
Alternative technique: rec

Related Products :

RP-0835H Recombinant Human IFN-gamma / IFNG / γ-IFN Protein 20μg 346 € adv human
MBS610191 Fragilis (1 8U, Ifitm3, Interferon Induced Transmembrane Protein 3, Interferon inducible protein 1 8U, Interferon Inducible Protein 15, Interferon Inducible Protein Homolog) Antibody 100ug 558 € MBS Polyclonals_1 human
CI57 Recombinant Human Interferon γ, IFN-γ 50 µg 202 € novo human
C014 Recombinant Human Interferon γ, IFN-γ (E. coli) 500 µg 369 € novo human
CM40 Recombinant Mouse Interferon γ, IFN-γ 1 mg 1674 € novo human
CM41 Recombinant Mouse Interferon γ, IFN-γ (C-6His) 50 µg 202 € novo human
CK42 Recombinant Mouse Interferon γ Receptor 1, IFN-γ R1, CD119 (C-6His) 1 mg 1674 € novo human
CK43 Recombinant Mouse Interferon γ Receptor 1, IFN-γ R1, CD119 (C-Fc) 10 µg 115 € novo human
RP-0829H Recombinant Human IFN-alpha / IFNA1 / IFN Protein (His Tag) 20μg 456 € adv human
YM5058 Interferon alpha 2b, NO X w/IFN beta or gamma, Clone: IFNA2.3, Mouse Monoclonal antibody-Human recombinant; Neutralizes/ELISA (coating)/IP 0.1mg Ask price € accurate-monoclonals human
GWB-633283 Interferon Gamma (IFN-g) recombinant 1 tube 579 € genways human
GWB-BB3356 antibody to or anti- Interferon Gamma (IFN-gamma) Mouse antibody 1 vial 845 € genways mouse
AE38824BO Bovine Interferon γ (IFN-γ) ELISA Kit 96 wells plate 678 € ab-elisa elisas human
AE38824BO-96 Bovine Interferon γ (IFN-γ) ELISA Kit 1x plate of 96 wells 587 € abebio human
E-EL-C0003 Canine IFN-γ (Interferon Gamma) ELISA 96T 624 € elabsciences human
AE38823CA Cat Interferon γ (IFN-γ) ELISA Kit 48 wells plate 500 € ab-elisa elisas human
AE38823CA-96 Cat Interferon γ (IFN-γ) ELISA Kit 1x plate of 96 wells 671 € abebio human
E-EL-Ch0026 Chicken IFN-γ (Interferon Gamma) ELISA Kit 96T 497 € elabsciences human
AE38822CH Chicken Interferon γ (IFN-γ) ELISA Kit 96 wells plate 739 € ab-elisa elisas human
AE38822CH-96 Chicken Interferon γ (IFN-γ) ELISA Kit 1x plate of 96 wells 587 € abebio human
AE38821DK Donkey Interferon γ (IFN-γ) ELISA Kit 48 wells plate 500 € ab-elisa elisas human
AE38821DK-96 Donkey Interferon γ (IFN-γ) ELISA Kit 1x plate of 96 wells 671 € abebio human
AE38792DU Duck Interferon γ (IFN-γ/IFNB) ELISA Kit 48 wells plate 500 € ab-elisa elisas human
AE38792DU-96 Duck Interferon γ (IFN-γ/IFNB) ELISA Kit 1x plate of 96 wells 671 € abebio human
AE38824BO-48 ELISA test for Bovine Interferon γ (IFN-γ) 1x plate of 48 wells 360 € abebio human
AE38823CA-48 ELISA test for Cat Interferon γ (IFN-γ) 1x plate of 48 wells 402 € abebio human
AE38822CH-48 ELISA test for Chicken Interferon γ (IFN-γ) 1x plate of 48 wells 431 € abebio human
AE38821DK-48 ELISA test for Donkey Interferon γ (IFN-γ) 1x plate of 48 wells 402 € abebio human
AE38792DU-48 ELISA test for Duck Interferon γ (IFN-γ/IFNB) 1x plate of 48 wells 402 € abebio human
AE38791FI-48 ELISA test for Fish Interferon γ (IFN-γ) 1x plate of 48 wells 402 € abebio human