Recombinant Human Vaccinia-Related Kinase 3, VRK3 (C-6His)

Contact us
Catalog number: CI42
Price: 2283 €
Supplier: novo
Product name: Recombinant Human Vaccinia-Related Kinase 3, VRK3 (C-6His)
Quantity: 1 mg
Other quantities: 10 µg 202€ 50 µg 496€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Vaccinia-related kinase 3 is produced by our Mammalian expression system and the target gene encoding Met1-Phe412 is expressed with a 6His tag at the C-terminus
Molecular Weight: 46, 9 kD
UniProt number: Q8IV63-2
State of the product: Liquid
Shipping conditions: Dry Ice/ice packs
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Supplied as a 0, pH7
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MISFCPDCGKSIQAAFKFCPYCGNSLPVEEHVGSQTFVNPHVSSFQGSKRGLNSSFETSPKKVKWSSTVTSPRLSLFSDGDSSESEDTLSSSERSKGSGSRPPTPKSSPQKTRKSPQVTRGSPQKTSCSPQKTRQSPQTLKRSRVTTSLEALPTGTVLTDKSGRQWKLKSFQTRDNQGILYEAAPTSTLTCDSGPQKQKFSLKLDAKDGRLFNEQNFFQRAAKPLQVNKWKKLYSTPLLAIPTCMGFGVHQDKYRFLVLPSLGRSLQSALDVSPKHVLSERSVLQVACRLLDALEFLHENEYVHGNVTAENIFVDPEDQSQVTLAGYGFAFRYCPSGKHVAYVEGSRSPHEGDLEFISMDLHKGCGPSRRSDLQSLGYCMLKWLYGFLPWTNCLPNTEDIMKQKQKLPWDSFVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: VRK3 (C-6His), Vaccinia-Related Kinase 3
Short name: VRK3 (C-6His), Recombinant Vaccinia- Kinase 3
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: VRK3 (C-6His), sapiens Vaccinia-Related phosphorylation catalyst 3, recombinant H
Alternative technique: rec
Identity: 18996
Gene: VRK3 | More about : VRK3
Long gene name: vaccinia related kinase 3
Locus: 19q13, 33
Discovery year: 2003-08-18
GenBank acession: AB031052
Entrez gene record: 51231
RefSeq identity: NM_016440
Havana BLAST/BLAT: OTTHUMG00000183053

Related Products :

CI42 Recombinant Human Vaccinia-Related Kinase 3, VRK3 (C-6His) 500 µg 1613 € novo human
MBS620008 Vaccinia Related Kinase 3 (VRK3) Antibody 100ul 564 € MBS Polyclonals_1 human
GWB-P0453K VRK3, 1-474aa, Recombinant Protein bulk Ask price € genways bulk human
MBS623744 NEK11L, CT (NIMA-related Kinase 11L, Never in Mitosis A-related Kinase 11, NimA-related Protein Kinase 11, NEK11, FLJ23495, Serine/threonine Protein Kinase Nek11) Antibody 200ul 603 € MBS Polyclonals_1 human
LV356255 VRK3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
AR50409PU-N anti-VRK3 (1-474, His-tag) Antibody 0,25 mg 1413 € acr human
AR50409PU-S anti-VRK3 (1-474, His-tag) Antibody 50 Вµg 587 € acr human
A01V0031 anti-VRK3 Antibody 200ug (50ug, 100ug available) 465 € Bluegen antibodies human
abx218517 Anti-VRK3 Antibody inquire 50 € abbex human
abx939556 Anti-VRK3 siRNA inquire 50 € abbex human
abx939557 Anti-VRK3 siRNA inquire 50 € abbex human
GWB-24FCC4 VRK3 Over-expression Lysate reagent 1 x 1 vial 873 € genways human
MBS623463 GLK, CT (Germinal Center Kinase Related Protein Kinase, Mitogen-activated Protein Kinase Kinase Kinase Kinase 3, MAP4K3, MAPKKKK3, MAPK/ERK Kinase Kinase Kinase 3, MEK Kinase Kinase 3, MEKKK 3, RAB8IPL1) Antibody 200ul 603 € MBS Polyclonals_1 human
MBS621291 Bcl 2-Related Protein A1 (Bcl 2 Related Protein A1, Bcl-2-related Protein A1, ACC-1, ACC-2, BCL2L5, BFL1, BFL-1, GRS, Hematopoietic Bcl2-related Protein A1, HBPA1, Hemopoietic-specific Early Response Protein, Protein BFL-1, Protein GRS) Antibody 50ug 724 € MBS Polyclonals_1 human
MBS622298 Hematopoietic Progenitor Kinase 1 (HPK1, Mitogen-activated Protein Kinase Kinase Kinase Kinase 1, MAP4K1, MAPK/ERK Kinase Kinase Kinase 1, MEK Kinase Kinase 1, MEKKK 1) Antibody 100ug 735 € MBS Polyclonals_1 human
MBS624216 MAP4K1, phosphorylated (Ser171) (Mitogen-activated Protein Kinase Kinase Kinase Kinase 1, MAPK/ERK Kinase Kinase Kinase 1, MEK Kinase Kinase 1, MEKKK 1, Hematopoietic Progenitor Kinase, HPK1) Antibody 200ul 603 € MBS Polyclonals_1 human
MBS621056 DRAK1 (DAP Kinase-related Apoptosis-inducing Protein Kinase 1, Death-associated Protein Kinase-related 1, Serine/threonine Kinase 17a Death Associated Protein Kinase Related 1, STK17A) 100ug 763 € MBS Polyclonals_1 human
CA82 Recombinant Human Fms-Related Tyrosine Kinase 3 Ligand, FLT3LG (C-6His) 500 µg 1613 € novo human
MBS624240 MINK1, 2, CT (Misshapen/NIK-related Kinase, Misshapen-like Kinase 1, MINK1, MINK, B55, GCK Family Kinase MiNK, hMINK, hMINKbeta, MAPK/ERK Kinase Kinase Kinase 6, MEK Kinase Kinase 6, MEKKK 6, Mitogen-activated Protein Kinase Kinase Kinase Kinase 6, MAP4K6 Antibody 200ul 597 € MBS Polyclonals_1 human
abx262524 Anti-Vaccinia Related Kinase 3 Protein (Recombinant) 10 µg 340 € abbex human
MBS623694 NEK4, CT (Never in Mitosis A-related Kinase 4, NimA-related Protein Kinase 4, MGC33171, NRK2, pp12301, Serine/threonine Protein Kinase 2, STK2, Serine/threonine Protein Kinase Nek4, Serine/threonine Protein Kinase NRK2) Antibody 200ul 603 € MBS Polyclonals_1 human
CF89 Recombinant Human Actin-Related Protein 8, ACTR8 (N-6His) 1 mg 2486 € novo human
CE33 Recombinant Human Autophagy Related 10 Homolog, ATG10 (C-6His, N-T7 tag) 50 µg 496 € novo human
CE30 Recombinant Human Autophagy Related 3 Homolog, ATG3 (C-6His, N-T7 tag) 1 mg 557 € novo human
CF50 Recombinant Human Autophagy Related 4 Homolog A, ATG4A (N-6His) 50 µg 496 € novo human
CE84 Recombinant Human Autophagy Related 4 Homolog C, ATG4C (C-6His) 500 µg 1613 € novo human
C103 Recombinant Human Bcl-2 Related Protein A1, BCL2A1 (C-6His) 1 mg 2283 € novo human
C823 Recombinant Human Carbonic Anhydrase-Related Protein 11, CA11 (C-6His) 10 µg 202 € novo human
C585 Recombinant Human Complement Factor H-Related 1, CFHR1 (C-6His) 1 mg 2283 € novo human
CC74 Recombinant Human Complement Factor H-related 5, CFHR5 (C-6His) 1 mg 2283 € novo human