| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Bcl-2 Related Protein A1 is produced by our E, coli expression system and the target gene encoding Met1-Ser152 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
18, 52 kD |
| UniProt number: |
Q16548 |
| State of the product: |
Liquid |
| Shipping conditions: |
Dry ice/ice packs |
| Formulation: |
1 mM DTT, 1 mM EDTA, 10% Glycerol, 150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 4, Supplied as a 0 |
| Storage recommendations: |
-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNVNVVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEPKSLEHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
BCL2A1 (C-6His), Bcl-2 Related Protein A1 |
| Short name: |
BCL2A1 (C-6His), Recombinant Bcl-2 Protein A1 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
B-cell CLL/lymphoma 2-related protein A1 (C-6His), sapiens Bcl-2 Related Protein A1, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
ACC-1 and ACC-2 and BCL2L5 and BFL1 and GRS and HBPA1, BCL2A1 and IDBG-25591 and ENSG00000140379 and 597, BCL2A1 and IDBG-630216 and ENSBTAG00000000735 and 282151, BH domain binding, Cytoplasm, this GO :0005515 and protein binding and molecular function this GO :0005741 and mitochondrial outer membrane and cellular component this GO :0008630 and intrinsic apoptotic signaling pathway in response to DNA damage and biological process this GO :0042803 and protein homodimerization activity and molecular function this GO :0042981 and regulation of apoptotic process and biological process this GO :0043066 and negative regulation of apoptotic process and biological process this GO :0045087 and innate immune response and biological process this GO :0046982 and protein heterodimerization activity and molecular function this GO :0051400 and BH domain binding and molecular function this GO :0097192 and extrinsic apoptotic signaling pathway in absence of ligand and biological process this GO :2001243 and negative regulation of intrinsic apoptotic signaling pathway and biological process, this GO :0005515 : protein binding, this GO :0005515 : protein binding and also this GO :0042803 : protein homodimerization activity and also this GO :0046982 : protein heterodimerization activity and also this GO :0051400 : BH domain binding, this GO :0042803 : protein homodimerization activity, this GO :0046982 : protein heterodimerization activity, this GO :0051400 : BH domain binding, BCL2-related protein A1 |
| Identity: |
991 |
| Gene: |
BCL2A1 |
More about : BCL2A1 |
| Long gene name: |
BCL2 related protein A1 |
| Synonyms gene: |
HBPA1 |
| Synonyms: |
GRS BFL1 BCL2L5 ACC-1 ACC-2 ACC2 ACC1 |
| Locus: |
15q25, 1 |
| Discovery year: |
1995-05-08 |
| Entrez gene record: |
597 |
| Pubmed identfication: |
8589678 12771180 |
| RefSeq identity: |
NM_004049 |
| Classification: |
Minor histocompatibility antigens BCL2 family |
| Havana BLAST/BLAT: |
OTTHUMG00000144173 |