| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Receptor agonists are often tested for drug development, FAS ligand and other ligands are binding to the receptor for signaling pathways for example in apoptosis or JNK signaling |
| Molecular Weight: |
15, 3 kD |
| UniProt number: |
Q9UNG2 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH 7 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
ETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFISVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
TNFSF18 (C-6His), GITR Ligand |
| Short name: |
TNFSF18 (C-6His), Recombinant GITR Ligand |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
member 18 (C-6His), sapiens GITR Ligand, tumor necrosis factor (ligand) superfamily, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
AITRL and GITRL and hGITRL and TL6, Extracellular, LOC768081 and IDBG-632315 and ENSBTAG00000047412 and 768081, TNFSF18 and IDBG-104861 and ENSG00000120337 and 8995, Tnfsf18 and IDBG-201543 and ENSMUSG00000066755 and 240873, member 18, this GO :0002309 and T cell proliferation involved in immune response and biological process this GO :0005102 and receptor binding and molecular function this GO :0005125 and cytokine activity and molecular function this GO :0005164 and tumor necrosis factor receptor binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005615 and extracellular space and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006955 and immune response and biological process this GO :0007165 and signal transduction and biological process this GO :0007267 and cell-cell signaling and biological process this GO :0009986 and cell surface and cellular component this GO :0016020 and membrane and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0032813 and tumor necrosis factor receptor superfamily binding and molecular function this GO :0033209 and tumor necrosis factor-mediated signaling pathway and biological process this GO :0042129 and regulation of T cell proliferation and biological process this GO :0043066 and negative regulation of apoptotic process and biological process this GO :0051092 and positive regulation of NF-kappaB transcription factor activity and biological process, this GO :0005102 : receptor binding, this GO :0005102 : receptor binding and also this GO :0005125 : cytokine activity and also this GO :0005164 : tumor necrosis factor receptor binding and also this GO :0005515 : protein binding and also this GO :0032813 : tumor necrosis factor receptor superfamily binding, this GO :0005125 : cytokine activity, this GO :0005164 : tumor necrosis factor receptor binding, this GO :0005515 : protein binding, this GO :0032813 : tumor necrosis factor receptor superfamily binding, tumor necrosis factor receptor superfamily binding, tumor necrosis factor (ligand) superfamily |
| Identity: |
11932 |
| Gene: |
TNFSF18 |
More about : TNFSF18 |
| Long gene name: |
tumor necrosis factor superfamily member 18 |
| Synonyms gene name: |
member 18 , tumor necrosis factor (ligand) superfamily |
| Synonyms: |
AITRL TL6 hGITRL |
| Locus: |
1q25, 1 |
| Discovery year: |
1999-01-15 |
| GenBank acession: |
AF117713 |
| Entrez gene record: |
8995 |
| Pubmed identfication: |
10037686 10074428 |
| RefSeq identity: |
NM_005092 |
| Classification: |
Tumor necrosis factor superfamily |
| Havana BLAST/BLAT: |
OTTHUMG00000034835 |