| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Complement component C8 gamma is produced by our E, coli expression system and the target gene encoding Gln21-Arg202 is expressed with a 6His tag at the N-terminus |
| Molecular Weight: |
22, 6 kD |
| UniProt number: |
P07360 |
| State of the product: |
Liquid |
| Shipping conditions: |
Dry Ice/ice packs |
| Formulation: |
150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 4, Supplied as a 0 |
| Storage recommendations: |
-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MGSSHHHHHHSSGLVPRGSHMQKPQRPRRPASPISTIQPKANFDAQQFAGTWLLVAVGSACRFLQEQGHRAEATTLHVAPQGTAMAVSTFRKLDGICWQVRQLYGDTGVLGRFLLQARGARGAVNVVVAETDYQSFAVLYLERAGQLSVKLYARSLPVSDSVLSGFEQRVQEAHLTEDQIFYFPKYGFCEAADQFHVLDEVRR |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
C8G (N-6His), Chain, Complement Component C8 &gamma |
| Short name: |
C8G (N-6His), Chain, Recombinant Complement Component C8 &gamma |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans |
| Alternative name: |
complement component 8, epitope, gamma polypeptide (N-6His), sapiens Complement Component C8 &gamma, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
C8C, C8G and IDBG-641426 and ENSBTAG00000010520 and 517356, C8G and IDBG-92880 and ENSG00000176919 and 733, C8g and IDBG-146088 and ENSMUSG00000015083 and 69379, Extracellular, alternative pathway and biological process this GO :0006958 and complement activation, classical pathway and biological process this GO :0019835 and cytolysis and biological process this GO :0019841 and retinol binding and molecular function this GO :0030449 and regulation of complement activation and biological process this GO :0032403 and protein complex binding and molecular function this GO :0045087 and innate immune response and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0072562 and blood microparticle and cellular component, gamma polypeptide, protein complex binding, this GO :0001848 and complement binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005579 and membrane attack complex and cellular component this GO :0005615 and extracellular space and cellular component this GO :0006957 and complement activation, this GO :0001848 : complement binding, this GO :0001848 : complement binding and also this GO :0019841 : retinol binding and also this GO :0032403 : protein complex binding, this GO :0019841 : retinol binding, this GO :0032403 : protein complex binding, complement component 8 |
| Identity: |
1354 |
| Gene: |
C8G |
More about : C8G |
| Long gene name: |
complement C8 gamma chain |
| Synonyms gene name: |
complement component 8, gamma polypeptide |
| Locus: |
9q34, 3 |
| Discovery year: |
1988-05-11 |
| GenBank acession: |
X06465 |
| Entrez gene record: |
733 |
| Classification: |
Complement system Lipocalins |
| Havana BLAST/BLAT: |
OTTHUMG00000020955 |