Recombinant Human Complement Component C8 γ Chain, C8G (N-6His)

Contact us
Catalog number: CH44
Price: 625 €
Supplier: MBS mono
Product name: Recombinant Human Complement Component C8 γ Chain, C8G (N-6His)
Quantity: 100ug
Other quantities: 1 mg 2283€ 50 µg 369€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Complement component C8 gamma is produced by our E, coli expression system and the target gene encoding Gln21-Arg202 is expressed with a 6His tag at the N-terminus
Molecular Weight: 22, 6 kD
UniProt number: P07360
State of the product: Liquid
Shipping conditions: Dry Ice/ice packs
Formulation: 150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 4, Supplied as a 0
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MGSSHHHHHHSSGLVPRGSHMQKPQRPRRPASPISTIQPKANFDAQQFAGTWLLVAVGSACRFLQEQGHRAEATTLHVAPQGTAMAVSTFRKLDGICWQVRQLYGDTGVLGRFLLQARGARGAVNVVVAETDYQSFAVLYLERAGQLSVKLYARSLPVSDSVLSGFEQRVQEAHLTEDQIFYFPKYGFCEAADQFHVLDEVRR
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: C8G (N-6His), Chain, Complement Component C8 &gamma
Short name: C8G (N-6His), Chain, Recombinant Complement Component C8 &gamma
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans
Alternative name: complement component 8, epitope, gamma polypeptide (N-6His), sapiens Complement Component C8 &gamma, recombinant H
Alternative technique: rec
Alternative to gene target: C8C, C8G and IDBG-641426 and ENSBTAG00000010520 and 517356, C8G and IDBG-92880 and ENSG00000176919 and 733, C8g and IDBG-146088 and ENSMUSG00000015083 and 69379, Extracellular, alternative pathway and biological process this GO :0006958 and complement activation, classical pathway and biological process this GO :0019835 and cytolysis and biological process this GO :0019841 and retinol binding and molecular function this GO :0030449 and regulation of complement activation and biological process this GO :0032403 and protein complex binding and molecular function this GO :0045087 and innate immune response and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0072562 and blood microparticle and cellular component, gamma polypeptide, protein complex binding, this GO :0001848 and complement binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005579 and membrane attack complex and cellular component this GO :0005615 and extracellular space and cellular component this GO :0006957 and complement activation, this GO :0001848 : complement binding, this GO :0001848 : complement binding and also this GO :0019841 : retinol binding and also this GO :0032403 : protein complex binding, this GO :0019841 : retinol binding, this GO :0032403 : protein complex binding, complement component 8
Identity: 1354
Gene: C8G | More about : C8G
Long gene name: complement C8 gamma chain
Synonyms gene name: complement component 8, gamma polypeptide
Locus: 9q34, 3
Discovery year: 1988-05-11
GenBank acession: X06465
Entrez gene record: 733
Classification: Complement system Lipocalins
Havana BLAST/BLAT: OTTHUMG00000020955

Related Products :

CH44 Recombinant Human Complement Component C8 γ Chain, C8G (N-6His) 1 mg 2283 € novo human
MBS620042 Tubulin, gamma (TUBG, Tubulin gamma 1 Chain, TUBG1, Tubulin gamma 2 Chain, TUBG2, Gamma 1 Tubulin, Gamma 2 Tubulin, Gamma Tubulin 1, Gamma Tubulin 2, Gamma Tubulin Complex Component 1, GCP 1, GCP-1, MGC131994, Xgam) (Cy3) Antibody 100ul 696 € MBS Polyclonals_1 human
abx576350 Anti-Human Complement Component 8g (C8g) ELISA Kit 96 tests 760 € abbex human
DL-C8g-Hu Human Complement Component 8g C8g ELISA Kit 96T 869 € DL elisas human
EKU03415 Complement Component 8g (C8g) ELISA kit 1 plate of 96 wells 783 € Biomatik ELISA kits human
AR50060PU-N anti-Complement C8G (21-202, His-tag) Antibody 0,5 mg 1109 € acr human
AR50060PU-S anti-Complement C8G (21-202, His-tag) Antibody 0,1 mg 485 € acr human
C405 Recombinant Human Complement Component C1q Receptor, C1QR1, CD93 (C-6His) 500 µg 1613 € novo human
abx150876 Anti-Human C8g ELISA Kit 96 tests 891 € abbex human
GWB-P0803J C8G, 21-202 aa , Human, His tag, E.coli bulk Ask price € genways bulk human
LV096400 C8G Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 517 € ABM lentivectors human
LV096401 C8G Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA) 1.0 µg DNA 517 € ABM lentivectors human
LV096402 C8G Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro) 1.0 µg DNA 517 € ABM lentivectors human
LV096403 C8G Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro) 1.0 µg DNA 517 € ABM lentivectors human
LV096405 C8G Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a) 1.0 µg DNA 517 € ABM lentivectors human
LV096404 C8G Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC) 1.0 µg DNA 517 € ABM lentivectors human
abx909941 Anti-C8G siRNA inquire 50 € abbex human
abx909942 Anti-C8G siRNA inquire 50 € abbex human
MBS611055 Heterochromatin Protein 1 gamma, (CBX3, chromobox homolog 3 (HP1 gamma homolog, Drosophila), HGNC:1553, HECH, HP1-GAMMA, HP1Hs-gamma, HP1 gamma homolog, chromobox homolog 3, chromobox homolog 3 (Drosophila HP1 gamma), heterochromatin protein HP1 gamma, he Antibody 100ug 591 € MBS Polyclonals_1 drosophila
abx261505 Anti-Complement Component 8, gamma Protein (Recombinant) 1 mg 3559 € abbex human
C329 Recombinant Human Complement Factor B, CFB (C-6His) 500 µg 1613 € novo human
CI77 Recombinant Human Complement Factor H, CFH (C-6His) 50 µg 496 € novo human
C585 Recombinant Human Complement Factor H-Related 1, CFHR1 (C-6His) 1 mg 2283 € novo human
CC74 Recombinant Human Complement Factor H-related 5, CFHR5 (C-6His) 1 mg 2283 € novo human
C517 Recombinant Human Complement Factor H-Related Protein 2, CFHR2 (C-6His) 50 µg 369 € novo human
CM41 Recombinant Mouse Interferon γ, IFN-γ (C-6His) 50 µg 202 € novo human
CK42 Recombinant Mouse Interferon γ Receptor 1, IFN-γ R1, CD119 (C-6His) 1 mg 1674 € novo human
abx166851 Anti-Complement Complement C4b Protein (Recombinant) 100 μg 847 € abbex human
C510 Recombinant Human Serum Amyloid P-Component, Pentraxin 2, SAP (C-6His) 500 µg 1613 € novo human
GENTAUR-58be30136fcf2 C1q Receptor, gamma (gC1qR, C1qBP, Complement component 1, Q subcomponent-binding protein) 100ug 625 € MBS mono human