| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human C1q receptor 1 is produced by our Mammalian expression system and the target gene encoding Ala24-Lys580 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
15 kD, 59 |
| UniProt number: |
Q9NPY3 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
ADTEAVVCVGTACYTAHSGKLSAAEAQNHCNQNGGNLATVKSKEEAQHVQRVLAQLLRREAALTARMSKFWIGLQREKGKCLDPSLPLKGFSWVGGGEDTPYSNWHKELRNSCISKRCVSLLLDLSQPLLPSRLPKWSEGPCGSPGSPGSNIEGFVCKFSFKGMCRPLALGGPGQVTYTTPFQTTSSSLEAVPFASAANVACGEGDKDETQSHYFLCKEKAPDVFDWGSSGPLCVSPKYGCNFNNGGCHQDCFEGGDGSFLCGCRPGFRLLDDLVTCASRNPCSSSPCRGGATCVLGPHGKNYTCRCPQGYQLDSSQLDCVDVDECQDSPCAQECVNTPGGFRCECWVGYEPGGPGEGACQDVDECALGRSPCAQGCTNTDGSFHCSCEEGYVLAGEDGTQCQDVDECVGPGGPLCDSLCFNTQGSFHCGCLPGWVLAPNGVSCTMGPVSLGPPSGPPDEEDKGEKEGSTVPRAATASPTRGPEGTPKATPTTSRPSLSSDAPITSAPLKMLAPSGSPGVWREPSIHHATAASGPQEPAGGDSSVATQNNDGTDGQKVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
C1QR1, CD93 (C-6His), Complement Component C1q Receptor |
| Short name: |
C1QR1, CD93 (C-6His), Recombinant Complement Component C1q Receptor |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
C1QR1, CD93 molecule (C-6His), sapiens Complement Component C1q Receptor, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
C1qR(P) and C1QR1 and C1qRP and CDw93 and dJ737E23, CD93 and IDBG-59518 and ENSG00000125810 and 22918, CD93 and IDBG-639107 and ENSBTAG00000004207 and 539690, Cd93 and IDBG-208971 and ENSMUSG00000027435 and 17064, Cell surfaces, carbohydrate binding, this GO :0001849 and complement component C1q binding and molecular function this GO :0004872 and receptor activity and molecular function this GO :0005509 and calcium ion binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0006909 and pha this GO cytosis and biological process this GO :0009986 and cell surface and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0016023 and cytoplasmic membrane-bounded vesicle and cellular component this GO :0016032 and viral process and biological process this GO :0016337 and single organismal cell-cell adhesion and biological process this GO :0030246 and carbohydrate binding and molecular function this GO :0042116 and macrophage activation and biological process, this GO :0001849 : complement component C1q binding, this GO :0001849 : complement component C1q binding and also this GO :0004872 : receptor activity and also this GO :0005509 : calcium ion binding and also this GO :0005515 : protein binding and also this GO :0030246 : carbohydrate binding, this GO :0004872 : receptor activity, this GO :0005509 : calcium ion binding, this GO :0005515 : protein binding, this GO :0030246 : carbohydrate binding, 1 and ECSM3 and MXRA4, CD93 molecule |
| Identity: |
15855 |
| Gene: |
CD93 |
More about : CD93 |
| Long gene name: |
CD93 molecule |
| Synonyms gene: |
MXRA4 C1QR1 |
| Synonyms gene name: |
matrix-remodelling associated 4 complement component 1, q subcomponent, receptor 1 CD93 antigen |
| Synonyms: |
C1qRP C1qR(P) dJ737E23, 1 CDw93 ECSM3 |
| Locus: |
20p11, 21 |
| Discovery year: |
2001-12-05 |
| GenBank acession: |
U94333 |
| Entrez gene record: |
22918 |
| Pubmed identfication: |
9047234 10648005 |
| RefSeq identity: |
NM_012072 |
| Classification: |
CD molecules C-type lectin domain containing |
| Havana BLAST/BLAT: |
OTTHUMG00000032058 |