Recombinant Human Repulsive Guidance Molecule A, RGMA (N-6His)
Contact us
Catalog number: CH40
Price: 774 €
Supplier: MBS Polyclonals_1
Product name: Recombinant Human Repulsive Guidance Molecule A, RGMA (N-6His)
Quantity: 100ug
Other quantities: 10 µg 146€ 50 µg 303€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: present in lysates used as reference for ELISA quantification of these molecules and their subunits, Whole adhesion and interacting molecules are 
Molecular Weight: 29, 8 kD
UniProt number: Q96B86
State of the product: Liquid
Shipping conditions: Dry Ice/ice packs
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM Tris, Supplied as a 0, pH8
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MNHKVHHHHHHMPHLRTFTDRFQTCKVQGAWPLIDNNYLNVQVTNTPVLPGSAATATSKLTIIFKNFQECVDQKVYQAEMDELPAAFVDGSKNGGDKHGANSLKITEKVSGQHVEIQAKYIGTTIVVRQVGRYLTFAVRMPEEVVNAVEDWDSQGLYLCLRGCPLNQQIDFQAFHTNAEGTGARRLAAASPAPTAPETFPYETAVAKCKEKLPVEDLYYQACVFDLLTTGDVNFTLAAYYALEDVKMLHSNKDKLHLYERTRDLPG
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: RGMA (N-6His), Repulsive Guidance Molecule A
Short name: RGMA (N-6His), Recombinant Repulsive Guidance Molecule A
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: RGMA (N-6His), sapiens Repulsive Guidance Molecule A, recombinant H
Alternative technique: rec
Identity: 30308
Gene: RGMA | More about : RGMA
Long gene name: repulsive guidance molecule family member a
Synonyms gene name: RGM domain family, member A
Synonyms: RGM RGMa
Locus: 15q26, 1
Discovery year: 2004-02-04
GenBank acession: AL390083
Entrez gene record: 56963
Pubmed identfication: 15975920
RefSeq identity: NM_020211
Havana BLAST/BLAT: OTTHUMG00000171781

Related Products :

CH40 Recombinant Human Repulsive Guidance Molecule A, RGMA (N-6His) 500 µg 1613 € novo human
GENTAUR-58be5b431845e Anti-Repulsive Guidance Molecule B, ALEXA Fluor 594 100 microliters 489 € Bioss Polyclonal Antibodies human
GENTAUR-58be5b4381249 Anti-Repulsive Guidance Molecule C, ALEXA Fluor 594 100 microliters 489 € Bioss Polyclonal Antibodies human
bs-11474R-A350 Repulsive Guidance Molecule B Antibody, ALEXA FLUOR 350 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-11474R-A488 Repulsive Guidance Molecule B Antibody, ALEXA FLUOR 488 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-11474R-A555 Repulsive Guidance Molecule B Antibody, ALEXA FLUOR 555 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-11474R-A594 Repulsive Guidance Molecule B Antibody, ALEXA FLUOR 594 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-11474R-A647 Repulsive Guidance Molecule B Antibody, ALEXA FLUOR 647 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-11474R-Biotin Repulsive Guidance Molecule B Antibody, Biotin Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-11474R Repulsive Guidance Molecule B Antibody 0.1ml 263 € Bioss Primary Unconjugated Antibodies human
bs-11474R-Cy3 Repulsive Guidance Molecule B Antibody, Cy3 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-11474R-Cy5 Repulsive Guidance Molecule B Antibody, Cy5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-11474R-Cy5.5 Repulsive Guidance Molecule B Antibody, Cy5.5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-11474R-Cy7 Repulsive Guidance Molecule B Antibody, Cy7 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-11474R-FITC Repulsive Guidance Molecule B Antibody, FITC Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-11474R-HRP Repulsive Guidance Molecule B Antibody, HRP Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-11475R-A350 Repulsive Guidance Molecule C Antibody, ALEXA FLUOR 350 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-11475R-A488 Repulsive Guidance Molecule C Antibody, ALEXA FLUOR 488 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-11475R-A555 Repulsive Guidance Molecule C Antibody, ALEXA FLUOR 555 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-11475R-A594 Repulsive Guidance Molecule C Antibody, ALEXA FLUOR 594 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-11475R-A647 Repulsive Guidance Molecule C Antibody, ALEXA FLUOR 647 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-11475R-Biotin Repulsive Guidance Molecule C Antibody, Biotin Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-11475R Repulsive Guidance Molecule C Antibody 0.1ml 263 € Bioss Primary Unconjugated Antibodies human
bs-11475R-Cy3 Repulsive Guidance Molecule C Antibody, Cy3 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-11475R-Cy5 Repulsive Guidance Molecule C Antibody, Cy5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-11475R-Cy5.5 Repulsive Guidance Molecule C Antibody, Cy5.5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-11475R-Cy7 Repulsive Guidance Molecule C Antibody, Cy7 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-11475R-FITC Repulsive Guidance Molecule C Antibody, FITC Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-11475R-HRP Repulsive Guidance Molecule C Antibody, HRP Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
MBS611754 RGMb (Repulsive Guidance Molecule B) Antibody 100ug 774 € MBS Polyclonals_1 human