| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
6His tag at the C-terminus, Recombinant Human GAMT is produced by our E, coli expression system and the target gene encoding Met1-Gly236 is expressed with a 6His tag at the N-terminus |
| Molecular Weight: |
29, 5 kD |
| UniProt number: |
Q14353 |
| State of the product: |
Liquid |
| Shipping conditions: |
Dry Ice/ice packs |
| Formulation: |
0 , 1 mMDTT, 2 um filtered solution of 20 mM TrisHCl, Supplied as a 0, pH 8 |
| Storage recommendations: |
-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MGSSHHHHHHSSGLVPRGSHMSAPSATPIFAPGENCSPAWGAAPAAYDAADTHLRILGKPVMERWETPYMHALAAAASSKGGRVLEVGFGMAIAASKVQEAPIDEHWIIECNDGVFQRLRDWAPRQTHKVIPLKGLWEDVAPTLPDGHFDGILYDTYPLSEETWHTHQFNFIKNHAFRLLKPGGVLTYCNLTSWGELMKSKYSDITIMFEETQVPALLEAGFRRENIRTEVMALVPPADCRYYAFPQMITPLVTKGLEHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
C-6His), GAMT (N, Guanidinoacetate N-Methyltransferase |
| Short name: |
C-6His), GAMT (N, Recombinant Guanidinoacetate N-Methyltransferase |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
C-6His), GAMT (N, sapiens Guanidinoacetate N-Methyltransferase, recombinant H |
| Alternative technique: |
rec |
| Identity: |
4136 |
| Gene: |
GAMT |
More about : GAMT |
| Long gene name: |
guanidinoacetate N-methyltransferase |
| Synonyms: |
PIG2 TP53I2 |
| Locus: |
19p13, 3 |
| Discovery year: |
1996-07-19 |
| GenBank acession: |
Z49878 |
| Entrez gene record: |
2593 |
| Pubmed identfication: |
9570966 8547310 |
| RefSeq identity: |
NM_138924 |
| Havana BLAST/BLAT: |
OTTHUMG00000180095 |
| Locus Specific Databases: |
LOVD - Leiden Open Variation Database |