| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
present in lysates used as reference for ELISA quantification of these molecules and their subunits, Whole adhesion and interacting molecules are |
| Molecular Weight: |
19, 4 kD |
| UniProt number: |
Q6PIZ9 |
| State of the product: |
Liquid |
| Shipping conditions: |
Dry ice/ice packs |
| Formulation: |
150 mM sodium chloride，10% Glycerol, 2 um filtered solution of 20 mM PB, 4, Supplied as a 0, pH7 |
| Storage recommendations: |
-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MNISHYVEKQRQDKMYSYSSDHTRVDEYYIEDTPIYGNLDDMISEPMDENCYEQMKARPEKSVNKMQEATPSAQATNETQMCYASLDHSVKGKRRKPRKQNTHFSDKDGDEQLHAIDASVSKTTLVDSFSPESQAVEENIHDDPIRLFGLIRAKREPINLEHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
TCRIM, TRAT1 (C-6His), TRIM, T Receptor Interacting Molecule |
| Short name: |
TCRIM, TRAT1 (C-6His), TRIM, Recombinant T Cell Receptor Interacting Molecule |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
T cellular receptor associated transmembrane adaptor 1 (C-6His), TCRIM, TRIM, sapiens T cellular Receptor Interacting Molecule, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
BT, Plasma membranes, TRAT1 and IDBG-49131 and ENSG00000163519 and 50852, Trat1 and IDBG-164471 and ENSMUSG00000030775 and 77647, this GO :0001920 and negative regulation of receptor recycling and biological process this GO :0005068 and transmembrane receptor protein tyrosine kinase adaptor activity and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006968 and cellular defense response and biological process this GO :0007165 and signal transduction and biological process this GO :0007173 and epidermal growth factor receptor signaling pathway and biological process this GO :0008543 and fibroblast growth factor receptor signaling pathway and biological process this GO :0038095 and Fc-epsilon receptor signaling pathway and biological process this GO :0042101 and T cell receptor complex and cellular component this GO :0045087 and innate immune response and biological process this GO :0048011 and neurotrophin TRK receptor signaling pathway and biological process this GO :0048015 and phosphatidylinositol-mediated signaling and biological process this GO :0050850 and positive regulation of calcium-mediated signaling and biological process this GO :0050852 and T cell receptor signaling pathway and biological process this GO :0050862 and positive regulation of T cell receptor signaling pathway and biological process this GO :0051051 and negative regulation of transport and biological process, this GO :0005068 : transmembrane receptor protein tyrosine kinase adaptor activity, this GO :0005068 : transmembrane receptor protein tyrosine kinase adaptor activity, transmembrane receptor protein tyrosine kinase adaptor activity, 53544 and IDBG-632053 and ENSBTAG00000000183 and 614942, T cell receptor associated transmembrane adaptor 1 |
| Identity: |
30698 |
| Gene: |
TRAT1 |
More about : TRAT1 |
| Long gene name: |
T-cell receptor associated transmembrane adaptor 1 |
| Synonyms gene: |
TCRIM |
| Synonyms gene name: |
T cell receptor interacting molecule T cell receptor associated transmembrane adaptor 1 |
| Synonyms: |
HSPC062 TRIM |
| Locus: |
3q13, 13 |
| Discovery year: |
2004-11-03 |
| GenBank acession: |
AJ240084 |
| Entrez gene record: |
50852 |
| Pubmed identfication: |
10663578 9687533 |
| RefSeq identity: |
NM_016388 |
| Havana BLAST/BLAT: |
OTTHUMG00000159198 |