Recombinant Human T Cell Receptor Interacting Molecule, TRIM, TCRIM, TRAT1 (C-6His)

Contact us
Catalog number: CF17
Price: 696 €
Supplier: MBS Polyclonals_1
Product name: Recombinant Human T Cell Receptor Interacting Molecule, TRIM, TCRIM, TRAT1 (C-6His)
Quantity: 100ug
Other quantities: 1 mg 2486€ 50 µg 496€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: present in lysates used as reference for ELISA quantification of these molecules and their subunits, Whole adhesion and interacting molecules are 
Molecular Weight: 19, 4 kD
UniProt number: Q6PIZ9
State of the product: Liquid
Shipping conditions: Dry ice/ice packs
Formulation: 150 mM sodium chloride,10% Glycerol, 2 um filtered solution of 20 mM PB, 4, Supplied as a 0, pH7
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MNISHYVEKQRQDKMYSYSSDHTRVDEYYIEDTPIYGNLDDMISEPMDENCYEQMKARPEKSVNKMQEATPSAQATNETQMCYASLDHSVKGKRRKPRKQNTHFSDKDGDEQLHAIDASVSKTTLVDSFSPESQAVEENIHDDPIRLFGLIRAKREPINLEHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: TCRIM, TRAT1 (C-6His), TRIM, T Receptor Interacting Molecule
Short name: TCRIM, TRAT1 (C-6His), TRIM, Recombinant T Cell Receptor Interacting Molecule
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: T cellular receptor associated transmembrane adaptor 1 (C-6His), TCRIM, TRIM, sapiens T cellular Receptor Interacting Molecule, recombinant H
Alternative technique: rec
Alternative to gene target: BT, Plasma membranes, TRAT1 and IDBG-49131 and ENSG00000163519 and 50852, Trat1 and IDBG-164471 and ENSMUSG00000030775 and 77647, this GO :0001920 and negative regulation of receptor recycling and biological process this GO :0005068 and transmembrane receptor protein tyrosine kinase adaptor activity and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006968 and cellular defense response and biological process this GO :0007165 and signal transduction and biological process this GO :0007173 and epidermal growth factor receptor signaling pathway and biological process this GO :0008543 and fibroblast growth factor receptor signaling pathway and biological process this GO :0038095 and Fc-epsilon receptor signaling pathway and biological process this GO :0042101 and T cell receptor complex and cellular component this GO :0045087 and innate immune response and biological process this GO :0048011 and neurotrophin TRK receptor signaling pathway and biological process this GO :0048015 and phosphatidylinositol-mediated signaling and biological process this GO :0050850 and positive regulation of calcium-mediated signaling and biological process this GO :0050852 and T cell receptor signaling pathway and biological process this GO :0050862 and positive regulation of T cell receptor signaling pathway and biological process this GO :0051051 and negative regulation of transport and biological process, this GO :0005068 : transmembrane receptor protein tyrosine kinase adaptor activity, this GO :0005068 : transmembrane receptor protein tyrosine kinase adaptor activity, transmembrane receptor protein tyrosine kinase adaptor activity, 53544 and IDBG-632053 and ENSBTAG00000000183 and 614942, T cell receptor associated transmembrane adaptor 1
Identity: 30698
Gene: TRAT1 | More about : TRAT1
Long gene name: T-cell receptor associated transmembrane adaptor 1
Synonyms gene: TCRIM
Synonyms gene name: T cell receptor interacting molecule T cell receptor associated transmembrane adaptor 1
Synonyms: HSPC062 TRIM
Locus: 3q13, 13
Discovery year: 2004-11-03
GenBank acession: AJ240084
Entrez gene record: 50852
Pubmed identfication: 10663578 9687533
RefSeq identity: NM_016388
Havana BLAST/BLAT: OTTHUMG00000159198

Related Products :

CF17 Recombinant Human T Cell Receptor Interacting Molecule, TRIM, TCRIM, TRAT1 (C-6His) 50 µg 496 € novo human
ACLX176PE TRIM/T-cell receptor interacting molecule, Mouse Monoclonal antibody-; Clone: TRIM-04 0.1 mg 530 € accurate-monoclonals mouse
SM3077P anti-TRAT1 / TRIM (29-186) Antibody 0,1 mg 398 € acr human
SM3077RP anti-TRAT1 / TRIM (29-186) Antibody 0,1 mg 587 € acr human
MBS619332 RIP3 (Receptor Interacting Protein 3, Receptor-interacting Protein 3, RIP-3, Receptor-interacting Serine/threonine Kinase 3, Receptor-interacting Serine/threonine-protein Kinase 3, RIP-like Protein Kinase 3, RIPK3) 100ug 857 € MBS Polyclonals_1 human
MBS617274 Lck Interacting Molecule (LIME, dJ583P15.4, FLJ20406, Lck Interacting Membrane Protein, Lck Interacting Transmembrane Adaptor 1, LIME1, LP8067, RP4 583P15.5) Antibody 100ug 735 € MBS Polyclonals_1 human
YM4020 T-Cell Receptor (TCR), Clone: TRIM-04, Mouse Monoclonal antibody- 0.1mg 760 € accurate-monoclonals mouse
MBS612537 Lck Interacting Molecule (Lime1, Lck interacting transmembrane adaptor 1, 2810038K19Rik, LIME, RIKEN cDNA 2810038K19 gene) 100ug 591 € MBS Polyclonals_1 human
MBS617707 JIP 1/2, SH3 (C-Jun-amino-terminal Kinase-interacting Protein 1, JNK-interacting Protein 1, JIP1, JIP-1, C-Jun-amino-terminal Kinase-interacting Protein 2, JNK-interacting Protein 2, JIP2, JIP-2, Islet-brain 1, IB1, IB-1, Islet-brain-2, IB2, IB-2, JNK MAP Antibody 100ug 663 € MBS Polyclonals_1 human
MBS612715 MIZF (MBD2 Interacting Zinc Finger Protein, Methyl CpG Binding Protein 2 Interacting Zinc Finger Protein, MBD2 (Methyl-CpG-Binding Protein)-Interacting Zinc Finger Protein) Antibody 200ul 558 € MBS Polyclonals_1 human
MBS621815 SNIP1 (Smad Nuclear Interacting Protein 1 (Smad Nuclear Interacting), Smad Nuclear-interacting Protein, dJ423B22.2, FLJ12553, RP3-423B22.3, Splicing Factor Arginine/serine Rich 4 (Pre mRNA Splicing Factor SRP75)) Antibody 100ul 785 € MBS Polyclonals_1 human
MBS619579 STK35 (Serine/threonine Protein Kinase 35, Clik1, CLP 36 Interacting Kinase, CLP-36-interacting Kinase, EC 2.7.1.37, PDLIM1-interacting Kinase 1) Antibody 100ug 735 € MBS Polyclonals_1 human
MBS623297 WIPF1 (WAS/WASL interacting protein family, Member 1, MGC111041, PRPL-2, PRPL-2 protein, WAS/WASL interacting protein family member 1, WASP-interacting protein, WASPIP, WIP, Wiskott-Aldrich syndrome protein interacting protein, Wiskott-Aldrich syndrome pr Antibody 100ug 591 € MBS Polyclonals_1 human
LV343289 TRAT1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
C435 Recombinant Human Cell Adhesion Molecule 3, CADM3, IGSF4B, SynCAM3 (C-6His) 500 µg 1613 € novo human
C341 Recombinant Human Endothelial Cell Adhesion Molecule, ESAM (C-6His) 50 µg 263 € novo human
C522 Recombinant Human Hepatocyte Cell Adhesion Molecule, HepaCAM (C-6His) 10 µg 202 € novo human
CP45 Recombinant Human Neural Cell Adhesion Molecule 1, NCAM-1, CD56 (C-6His) 1 mg 2283 € novo human
CS74 Recombinant Human Platelet Endothelial Cell Adhesion Molecule, PECAM-1, CD31 (C-6His) 50 µg 202 € novo human
GENTAUR-58be3ca1e7da3 Anti- TRAT1 Antibody 100ug 393 € MBS Polyclonals human
GENTAUR-58be58ce917a7 Anti- TRAT1 Antibody 50ug 365 € MBS Polyclonals human
GENTAUR-58be58cf008c4 Anti- TRAT1 Antibody 0.2 mg 663 € MBS Polyclonals human
abx937968 Anti-TRAT1 siRNA 30 nmol 717 € abbex human
abx937969 Anti-TRAT1 siRNA 15 nmol 528 € abbex human
CM49 Recombinant Mouse Endothelial Cell-Specific Molecule , Endocan, ESM-1 (C-6His) 10 µg 126 € novo mouse
MBS623413 TRIP13, NT (Thyroid Receptor-interacting Protein 13, Thyroid Hormone Receptor Interactor 13, TR-interacting Protein 13, TRIP-13, Human Papillomavirus Type 16 E1 Protein-binding Protein, HPV16 E1 Protein-binding Protein, 16E1-BP) Antibody 200ul 603 € MBS Polyclonals_1 human
abx140125 Anti-TRIM Antibody inquire 50 € abbex human
abx140126 Anti-TRIM Antibody (PE) inquire 50 € abbex human
GWB-370F25 TRIM antibody 1 x 1 vial 532 € genways human
MBS622737 TRIM14 (Tripartite Motif Containing 14, Tripartite Motif-containing 14, Tripartite Motif Protein 14, Tripartite Motif Protein TRIM14, TRIM 14, 5830400N10Rik, KIAA0129) 100ug 696 € MBS Polyclonals_1 human