| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
6His tag at the N-terminus, Recombinant Human CD72 is produced by our E, coli expression system and the target gene encoding Arg117-Cys226 is expressed with a Trx |
| Molecular Weight: |
30, 6 kD |
| UniProt number: |
P21854 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLAGSGSGHMHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSMRYLQVSQQLQQTNRVLEVTNSSLRQQLRLKITQLGQSAEDLQGSRRELAQSQEALQVEQRAHQAAEGQLQACQADRQKTKETLQSEEQQRRALEQKLSNMENRLKPFFTC |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
6His), Lyb‑2 (N-Trx, B Differentiation CD72 |
| Short name: |
6His), Lyb‑2 (N-Trx, Recombinant B-Cell Differentiation Antigen CD72 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans |
| Alternative name: |
6His), Lyb‑2 (N-Trx, sapiens B-cellular Differentiation protein CD72 molecule, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
CD72 and IDBG-62668 and ENSG00000137101 and 971, CD72 and IDBG-633031 and ENSBTAG00000011409 and 783725, CD72b and LYB2, Cd72 and IDBG-141026 and ENSMUSG00000028459 and 12517, Plasma membranes, carbohydrate binding, this GO :0004888 and transmembrane signaling receptor activity and molecular function this GO :0005102 and receptor binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0007155 and cell adhesion and biological process this GO :0007165 and signal transduction and biological process this GO :0007411 and axon guidance and biological process this GO :0030246 and carbohydrate binding and molecular function, this GO :0004888 : transmembrane signaling receptor activity, this GO :0004888 : transmembrane signaling receptor activity and also this GO :0005102 : receptor binding and also this GO :0005515 : protein binding and also this GO :0030246 : carbohydrate binding, this GO :0005102 : receptor binding, this GO :0005515 : protein binding, this GO :0030246 : carbohydrate binding, CD72 molecule |
| Identity: |
1696 |
| Gene: |
CD72 |
More about : CD72 |
| Long gene name: |
CD72 molecule |
| Synonyms gene name: |
CD72 antigen |
| Synonyms: |
LYB2 CD72b |
| Locus: |
9p13, 3 |
| Discovery year: |
1991-10-04 |
| Entrez gene record: |
971 |
| Pubmed identfication: |
2044654 1711157 |
| RefSeq identity: |
NM_001782 |
| Classification: |
CD molecules C-type lectin domain containing |
| Havana BLAST/BLAT: |
OTTHUMG00000019870 |