| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
6His tag at the N-terminus, Recombinant Human Endoglin is produced by our E, coli expression system and the target gene encoding Glu26-Gln176 is expressed with a Trx |
| Molecular Weight: |
33, 6 kD |
| UniProt number: |
P17813 |
| State of the product: |
Liquid |
| Shipping conditions: |
Dry Ice/ice packs |
| Formulation: |
2 um filtered solution of 20 mM PB，150 mM sodium chloride, 4, Supplied as a 0, pH7 |
| Storage recommendations: |
-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLAGSGSGHMHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMETVHCDLQPVGPERDEVTYTTSQVSKGCVAQAPNAILEVHVLFLEFPTGPSQLELTLQASKQNGTWPREVLLVLSVNSSVFLHLQALGIPLHLAYNSSLVTFQEPPGVNTTELPSFPKTQILEWAAERGPITSAAELNDPQSILLRLGQAQ |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
6His), CD105 (N-Trx, Endoglin |
| Short name: |
6His), CD105 (N-Trx, Recombinant Endoglin |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
6His), CD105 (N-Trx, sapiens Endoglin, recombinant H |
| Alternative technique: |
rec |
| Identity: |
3349 |
| Gene: |
ENG |
More about : ENG |
| Long gene name: |
endoglin |
| Synonyms gene: |
ORW1 ORW |
| Synonyms gene name: |
Osler-Rendu-Weber syndrome 1 |
| Synonyms: |
END HHT1 CD105 |
| Locus: |
9q34, 11 |
| Discovery year: |
1993-03-03 |
| GenBank acession: |
AF035753 |
| Entrez gene record: |
2022 |
| Pubmed identfication: |
8404038 10548503 |
| Classification: |
CD molecules |
| Havana BLAST/BLAT: |
OTTHUMG00000020723 |
| Locus Specific Databases: |
Hereditary Hemorrhagic Telangiectasia (HHT) Mutation Database LRG_589 |