Recombinant Human B-Cell Differentiation Antigen CD72, Lyb‑2 (N-Trx, 6His)

Contact us
Catalog number: CF13
Price: Ask price €
Supplier: accurate-monoclonals
Product name: Recombinant Human B-Cell Differentiation Antigen CD72, Lyb‑2 (N-Trx, 6His)
Quantity: vial
Other quantities: 1 mg 2486€ 10 µg 202€ 500 µg 1755€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: 6His tag at the N-terminus, Recombinant Human CD72 is produced by our E, coli expression system and the target gene encoding Arg117-Cys226 is expressed with a Trx
Molecular Weight: 30, 6 kD
UniProt number: P21854
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLAGSGSGHMHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSMRYLQVSQQLQQTNRVLEVTNSSLRQQLRLKITQLGQSAEDLQGSRRELAQSQEALQVEQRAHQAAEGQLQACQADRQKTKETLQSEEQQRRALEQKLSNMENRLKPFFTC
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: 6His), Lyb‑2 (N-Trx, B Differentiation CD72
Short name: 6His), Lyb‑2 (N-Trx, Recombinant B-Cell Differentiation Antigen CD72
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans
Alternative name: 6His), Lyb‑2 (N-Trx, sapiens B-cellular Differentiation protein CD72 molecule, recombinant H
Alternative technique: rec
Alternative to gene target: CD72 and IDBG-62668 and ENSG00000137101 and 971, CD72 and IDBG-633031 and ENSBTAG00000011409 and 783725, CD72b and LYB2, Cd72 and IDBG-141026 and ENSMUSG00000028459 and 12517, Plasma membranes, carbohydrate binding, this GO :0004888 and transmembrane signaling receptor activity and molecular function this GO :0005102 and receptor binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0007155 and cell adhesion and biological process this GO :0007165 and signal transduction and biological process this GO :0007411 and axon guidance and biological process this GO :0030246 and carbohydrate binding and molecular function, this GO :0004888 : transmembrane signaling receptor activity, this GO :0004888 : transmembrane signaling receptor activity and also this GO :0005102 : receptor binding and also this GO :0005515 : protein binding and also this GO :0030246 : carbohydrate binding, this GO :0005102 : receptor binding, this GO :0005515 : protein binding, this GO :0030246 : carbohydrate binding, CD72 molecule
Identity: 1696
Gene: CD72 | More about : CD72
Long gene name: CD72 molecule
Synonyms gene name: CD72 antigen
Synonyms: LYB2 CD72b
Locus: 9p13, 3
Discovery year: 1991-10-04
Entrez gene record: 971
Pubmed identfication: 2044654 1711157
RefSeq identity: NM_001782
Classification: CD molecules C-type lectin domain containing
Havana BLAST/BLAT: OTTHUMG00000019870

Related Products :

CF13 Recombinant Human B-Cell Differentiation Antigen CD72, Lyb‑2 (N-Trx, 6His) 10 µg 202 € novo human
MBS620009 CD1c (Cluster of differentiation antigen 1c, CD1c antigen, CD1c antigen c polypeptide, CD1c molecule, Cortical thymocyte antigen CD1c, Differentiation antigen CD1 alpha 3, R7, T cell surface glycoprotein CD1c) Antibody 100ug 774 € MBS Polyclonals_1 human
GWB-FE9603 CD72 Antigen (CD72) Rabbit antibody to or anti-Human Polyclonal (aa1-98) antibody 1 vial 648 € genways human
C215 Recombinant Human Cyclophilin C, PPIase C, PPIC (N-Trx, 6His) 10 µg 202 € novo human
CG65 Recombinant Human Endoglin, CD105 (N-Trx, 6His) 500 µg 1613 € novo human
C279 Recombinant Human Hydroxyacid Oxidase 1, HAO1 (N-Trx, 6His) 10 µg 202 € novo human
CE54 Recombinant Human Serpin B6, Placental Thrombin Inhibitor (N-Trx, 6His) 50 µg 496 € novo human
CG82 Recombinant Human Sterol O-Acyltransferase 2, SOAT2, ACAT2 (N-Trx, 6His) 50 µg 496 € novo human
MBS621812 MyD88, CT, Blocking Peptide (Myeloid Differentiation Marker 88, Myeloid Differentiation Primary Response Gene, Myeloid Differentiation Primary Response Protein MyD88) Antibody 100ug 558 € MBS Polyclonals_1 human
DL-CD72-Hu Human Cluster Of Differentiation 72 CD72 ELISA Kit 96T 869 € DL elisas human
GENTAUR-58bdd43374e6f Anti- Cluster Of Differentiation 72 (CD72) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bdd527d8997 Anti- Cluster Of Differentiation 72 (CD72) Antibody 100ug 503 € MBS Polyclonals human
GENTAUR-58bdd5283701b Anti- Cluster Of Differentiation 72 (CD72) Antibody 50ug 382 € MBS Polyclonals human
GENTAUR-58bdd7a2b138e Anti- Cluster Of Differentiation 72 (CD72) Antibody 100ug 509 € MBS Polyclonals human
GENTAUR-58bdd81e86433 Anti- Cluster Of Differentiation 72 (CD72) Antibody 50ug 365 € MBS Polyclonals human
GENTAUR-58bdd81ed6b0e Anti- Cluster Of Differentiation 72 (CD72) Antibody 100ug 470 € MBS Polyclonals human
GENTAUR-58bddb2a1a6c8 Anti- Cluster Of Differentiation 72 (CD72) Antibody 100ug 575 € MBS Polyclonals human
GENTAUR-58bddd2371143 Anti- Cluster Of Differentiation 72 (CD72) Antibody 100ug 542 € MBS Polyclonals human
EKU03245 Cluster Of Differentiation 72 (CD72) ELISA kit 1 plate of 96 wells 783 € Biomatik ELISA kits human
CR23 Recombinant Human Induced Myeloid Leukemia Cell Differentiation Protein Mcl-1, MCL1L (N-6His) 50 µg 496 € novo human
RP-0126H Recombinant Human BCL6 / B-cell CLL lymphoma 6 Protein (aa 1-150, His & Trx Tag) 50μg 572 € adv human
GWB-14E1C4 Recombinant Human Myeloid Cell Nuclear Differentiation Antigen 500 ug 662 € genways bulk human
MBS621925 EDG1 (Endothelial Cell Differentiation Gene 1, EDG 1, EDG-1, Endothelial Differentiation Sphingolipid G Protein Coupled Receptor 1, CHEDG1, D1S3362, G Protein Coupled Sphingolipid Receptor, Sphingosine 1-phosphate Receptor Edg-1, Sphingosine 1-phosphate R Antibody 100ug 569 € MBS Polyclonals_1 human
abx166669 Anti-Myeloid Cell Nuclear Differentiation Antigen Protein (Recombinant) 50 μg 601 € abbex human
abx262871 Anti-Myeloid Cell Nuclear Differentiation Antigen Protein (Recombinant) 10 µg 340 € abbex human
CE12 Recombinant Human Endothelial Differentiation-Related Factor 1, EDF1, MBF1 (C-6His) 10 µg 202 € novo human
THRX25-R Purified Recombinant (E coli, >95%) Human Thioredoxin 2 (Trx2/Mitochodrial/Mt-Trx) protein 25 μg 304 € adi human
CG47 Recombinant Human ATP-binding Cassette B5, ABCB5 (N-Trx) 10 µg 202 € novo human
RP-1441H Recombinant Human SOCS3 / CIS3 Protein (His & Trx Tag) 20μg 572 € adv human
OBT0263F CD72, B-Cell, 86kD homodimer, Clone: 3F3, Mouse Monoclonal antibody-Human, FITC; flow vial Ask price € accurate-monoclonals human