| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
6His tag at the N-terminus, Recombinant Human Cyclophilin C is produced by our E, coli expression system and the target gene encoding Lys31-Asp182 is expressed with a Trx |
| Molecular Weight: |
33, 78 kD |
| UniProt number: |
P45877 |
| State of the product: |
Liquid |
| Shipping conditions: |
Dry ice/ice packs |
| Formulation: |
10% Glycerol, 150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 4, Supplied as a 0 |
| Storage recommendations: |
-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLAGSGSGHMHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMAKRGPSVTAKVFFDVRIGDKDVGRIVIGLFGKVVPKTVENFVALATGEKGYGYKGSKFHRVIKDFMIQGGDITTGDGTGGVSIYGETFPDENFKLKHYGIGWVSMANAGPDTNGSQFFITLTKPTWLDGKHVVFGKVIDGMTVVHSIELQATD |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
6His), PPIC (N-Trx, PPIase C, Cyclophilin C |
| Short name: |
6His), PPIC (N-Trx, PPIase C, Recombinant Cyclophilin C |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
6His), PPIase C, peptidylprolyl isomerase C (cyclophilin C) (N-Trx, sapiens Cyclophilin C, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
CYPC, Cytoplasm, PPIC and IDBG-39025 and ENSG00000168938 and 5480, PPIC and IDBG-644954 and ENSBTAG00000001568 and 535494, Ppic and IDBG-147010 and ENSMUSG00000024538 and 19038, this GO :0000413 and protein peptidyl-prolyl isomerization and biological process this GO :0003755 and peptidyl-prolyl cis-trans isomerase activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005737 and cytoplasm and cellular component this GO :0006457 and protein folding and biological process this GO :0007165 and signal transduction and biological process this GO :0016018 and cyclosporin A binding and molecular function this GO :0051082 and unfolded protein binding and molecular function this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0003755 : peptidyl-prolyl cis-trans isomerase activity, this GO :0003755 : peptidyl-prolyl cis-trans isomerase activity and also this GO :0005515 : protein binding and also this GO :0016018 : cyclosporin A binding and also this GO :0051082 : unfolded protein binding, this GO :0005515 : protein binding, this GO :0016018 : cyclosporin A binding, this GO :0051082 : unfolded protein binding, unfolded protein binding, peptidylprolyl isomerase C (cyclophilin C) |
| Identity: |
9256 |
| Gene: |
PPIC |
More about : PPIC |
| Long gene name: |
peptidylprolyl isomerase C |
| Synonyms: |
CYPC |
| Synonyms name: |
cyclophilin C |
| Locus: |
5q23, 2 |
| Discovery year: |
1993-06-18 |
| GenBank acession: |
S71018 |
| Entrez gene record: |
5480 |
| Pubmed identfication: |
1383094 8031755 |
| RefSeq identity: |
NM_000943 |
| Classification: |
Cyclophilin peptidylprolyl isomerases |
| Havana BLAST/BLAT: |
OTTHUMG00000128921 |